Recombinant Human AMIGO3, His-tagged

Cat.No. : AMIGO3-29H
Product Overview : Recombinant Human Amphoterin-Induced Protein 3/AMIGO3 produced by transfected human cells is a secreted protein with sequence (Thr20-Thr383) of Human AMIGO3 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-383 a.a.
Description : Amphoterin-Induced Gene and ORF 3 (AMIGO3) is a member of the AMIGO family. AMIGO family proteins are cell adhesion molecules, which exhibits homophilic and heterophilic binding properties, plays an important role in neuronal axon tract development. AMIGO3 is a type I transmembrane proteins, includes six leucine-rich repeats (CRRs) and Ig domain in the extracellular domains. AMIGO3 can be expressed and detected in all tissues, may mediates heterophilic cell-cell interaction, contributes to signal transduction through its intracellular domain.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : TPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPL FQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLD EHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGL YLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPAL GLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQE QHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name AMIGO3 adhesion molecule with Ig-like domain 3 [ Homo sapiens ]
Official Symbol AMIGO3
Synonyms AMIGO3; adhesion molecule with Ig-like domain 3; amphoterin-induced protein 3; amphoterin induced gene and open reading frame 3; alivin-3; amphoterin-induced gene and ORF 3; AMIGO-3; MGC120552;
Gene ID 386724
mRNA Refseq NM_198722
Protein Refseq NP_942015
UniProt ID Q86WK7
Chromosome Location 3p21

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMIGO3 Products

Required fields are marked with *

My Review for All AMIGO3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon