| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
20-383 a.a. |
| Description : |
Amphoterin-Induced Gene and ORF 3 (AMIGO3) is a member of the AMIGO family. AMIGO family proteins are cell adhesion molecules, which exhibits homophilic and heterophilic binding properties, plays an important role in neuronal axon tract development. AMIGO3 is a type I transmembrane proteins, includes six leucine-rich repeats (CRRs) and Ig domain in the extracellular domains. AMIGO3 can be expressed and detected in all tissues, may mediates heterophilic cell-cell interaction, contributes to signal transduction through its intracellular domain. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| AA Sequence : |
TPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPL FQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNTLRALGRHDLDGLGALEKLLLFNNRLVHLD EHAFHGLRALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGL YLHNNPLPCDCRLYHLLQRWHQRGLSAVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPAL GLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQE QHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
