Recombinant Human AMN1 protein, His-tagged
| Cat.No. : | AMN1-7854H |
| Product Overview : | Recombinant Human AMN1 protein(1-213 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-213 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY |
| Gene Name | AMN1 antagonist of mitotic exit network 1 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | AMN1 |
| Synonyms | AMN1; antagonist of mitotic exit network 1 homolog (S. cerevisiae); protein AMN1 homolog; |
| Gene ID | 196394 |
| mRNA Refseq | NM_001113402 |
| Protein Refseq | NP_001106873 |
| UniProt ID | Q8IY45 |
| ◆ Recombinant Proteins | ||
| AMN1-311R | Recombinant Rat AMN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AMN1-9621H | Recombinant Human AMN1, GST-tagged | +Inquiry |
| AMN1-4399Z | Recombinant Zebrafish AMN1 | +Inquiry |
| AMN1-7854H | Recombinant Human AMN1 protein, His-tagged | +Inquiry |
| AMN1-655R | Recombinant Rat AMN1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMN1 Products
Required fields are marked with *
My Review for All AMN1 Products
Required fields are marked with *
