Recombinant Human AMY2A protein, His-tagged
| Cat.No. : | AMY2A-3520H |
| Product Overview : | Recombinant Human AMY2A protein(162-511 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 162-511 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AMY2A amylase, alpha 2A (pancreatic) [ Homo sapiens ] |
| Official Symbol | AMY2A |
| Synonyms | AMY2A; amylase, alpha 2A (pancreatic); AMY2, amylase, alpha 2A; pancreatic; pancreatic alpha-amylase; glycogenase; alpha-amylase; found in the pancreas; pancreatic amylase 2A; pancreatic amylase alpha 2A; amylase, pancreatic, alpha-2A; 1,4-alpha-D-glucan glucanohydrolase; PA; AMY2; AMY2B; |
| Gene ID | 279 |
| mRNA Refseq | NM_000699 |
| Protein Refseq | NP_000690 |
| MIM | 104650 |
| UniProt ID | P04746 |
| ◆ Recombinant Proteins | ||
| AMY2A-194C | Recombinant Cynomolgus AMY2A, Fc-tagged | +Inquiry |
| AMY2A-56C | Recombinant Cynomolgus AMY2A, His tagged | +Inquiry |
| AMY2A-0555H | Recombinant Human AMY2A Protein (Asp188-Val432), N-His-tagged | +Inquiry |
| AMY2A-1116C | Recombinant Chicken AMY2A | +Inquiry |
| AMY2A-535H | Recombinant Human AMY2A protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| AMY2A-8353H | Native Human AMY2A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMY2A-1351HCL | Recombinant Human AMY2A cell lysate | +Inquiry |
| AMY2A-001CCL | Recombinant Cynomolgus AMY2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMY2A Products
Required fields are marked with *
My Review for All AMY2A Products
Required fields are marked with *
