Recombinant Human AMY2B Protein, His-tagged
| Cat.No. : | AMY2B-231H | 
| Product Overview : | Recombinant Human AMY2B fused with His tag at C-terminal was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Description : | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. | 
| Form : | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 | 
| Molecular Mass : | 56.9kD | 
| AA Sequence : | QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH* | 
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). | 
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining | 
| Gene Name | AMY2B amylase, alpha 2B (pancreatic) [ Homo sapiens ] | 
| Official Symbol | AMY2B | 
| Synonyms | AMY2B; amylase, alpha 2B (pancreatic); AMY2, amylase, alpha 2B; pancreatic; alpha-amylase 2B; glycogenase; alpha-amylase carcinoid; carcinoid alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase 2B; AMY2; | 
| Gene ID | 280 | 
| mRNA Refseq | NM_020978 | 
| Protein Refseq | NP_066188 | 
| MIM | 104660 | 
| UniProt ID | P19961 | 
| ◆ Recombinant Proteins | ||
| AMY2B-1032HF | Recombinant Full Length Human AMY2B Protein, GST-tagged | +Inquiry | 
| AMY2B-294H | Recombinant Human AMY2B Protein, Fc-tagged | +Inquiry | 
| AMY2B-9630H | Recombinant Human AMY2B, His-tagged | +Inquiry | 
| AMY2B-0084H | Recombinant Human AMY2B Protein (Gln16-Leu511), C-His-tagged | +Inquiry | 
| AMY2B-231H | Recombinant Human AMY2B Protein, His-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AMY2B-8873HCL | Recombinant Human AMY2B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMY2B Products
Required fields are marked with *
My Review for All AMY2B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            