Recombinant Human AMZ1 protein, GST-tagged
Cat.No. : | AMZ1-537H |
Product Overview : | Human AMZ1 full-length ORF (BAG52482.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AMZ1 (Archaelysin Family Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is AMZ2. |
Molecular Mass : | 58.3 kDa |
AA Sequence : | MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLAEAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHGHVPRALPPSGPGELPLAPLPHAGCAQPGRGPAAAPGPLSHLPEEAAACPGFQAHREVPETLHLDSGGGGDVAQPGGGGAVSVGGHPACQRRLGHVL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMZ1 archaelysin family metallopeptidase 1 [ Homo sapiens ] |
Official Symbol | AMZ1 |
Synonyms | AMZ1; archaelysin family metallopeptidase 1; archaemetzincin-1; archaemetzincin 1; KIAA1950; metalloproteinase-like protein; archeobacterial metalloproteinase-like protein 1; |
Gene ID | 155185 |
mRNA Refseq | NM_133463 |
Protein Refseq | NP_597720 |
MIM | 615168 |
UniProt ID | Q400G9 |
◆ Recombinant Proteins | ||
AMZ1-537H | Recombinant Human AMZ1 protein, GST-tagged | +Inquiry |
Amz1-1618M | Recombinant Mouse Amz1 Protein, Myc/DDK-tagged | +Inquiry |
AMZ1-1389HF | Recombinant Full Length Human AMZ1 Protein, GST-tagged | +Inquiry |
AMZ1-192H | Recombinant Human AMZ1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMZ1-1990H | Recombinant Human AMZ1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMZ1 Products
Required fields are marked with *
My Review for All AMZ1 Products
Required fields are marked with *
0
Inquiry Basket