Recombinant Human AMZ1 protein, GST-tagged

Cat.No. : AMZ1-537H
Product Overview : Human AMZ1 full-length ORF (BAG52482.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AMZ1 (Archaelysin Family Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is AMZ2.
Molecular Mass : 58.3 kDa
AA Sequence : MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLAEAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHGHVPRALPPSGPGELPLAPLPHAGCAQPGRGPAAAPGPLSHLPEEAAACPGFQAHREVPETLHLDSGGGGDVAQPGGGGAVSVGGHPACQRRLGHVL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMZ1 archaelysin family metallopeptidase 1 [ Homo sapiens ]
Official Symbol AMZ1
Synonyms AMZ1; archaelysin family metallopeptidase 1; archaemetzincin-1; archaemetzincin 1; KIAA1950; metalloproteinase-like protein; archeobacterial metalloproteinase-like protein 1;
Gene ID 155185
mRNA Refseq NM_133463
Protein Refseq NP_597720
MIM 615168
UniProt ID Q400G9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AMZ1 Products

Required fields are marked with *

My Review for All AMZ1 Products

Required fields are marked with *

0
cart-icon