Recombinant Human ANAPC1 protein, GST-tagged
Cat.No. : | ANAPC1-540H |
Product Overview : | Human ANAPC1 partial ORF ( NP_073153, 1841 a.a. - 1944 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the anaphase-promoting complex. This complex is an E3 ubiquitin ligase that regulates progression through the metaphase to anaphase portion of the cell cycle by ubiquitinating proteins which targets them for degradation. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 37.18 kDa |
AA Sequence : | NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANAPC1 anaphase promoting complex subunit 1 [ Homo sapiens ] |
Official Symbol | ANAPC1 |
Synonyms | ANAPC1; anaphase promoting complex subunit 1; anaphase-promoting complex subunit 1; APC1; MCPR; TSG24; cyclosome subunit 1; mitotic checkpoint regulator; testis-specific gene 24 protein; anaphase-promoting complex 1 (meiotic checkpoint regulator); |
Gene ID | 64682 |
mRNA Refseq | NM_022662 |
Protein Refseq | NP_073153 |
MIM | 608473 |
UniProt ID | Q9H1A4 |
◆ Recombinant Proteins | ||
ANAPC1-519M | Recombinant Mouse ANAPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Anapc1-3448M | Recombinant Mouse Anapc1, His-tagged | +Inquiry |
ANAPC1-540H | Recombinant Human ANAPC1 protein, GST-tagged | +Inquiry |
ANAPC1-9633H | Recombinant Human ANAPC1, His-tagged | +Inquiry |
ANAPC1-1619M | Recombinant Mouse ANAPC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC1 Products
Required fields are marked with *
My Review for All ANAPC1 Products
Required fields are marked with *
0
Inquiry Basket