Recombinant Human ANAPC1 protein, GST-tagged

Cat.No. : ANAPC1-540H
Product Overview : Human ANAPC1 partial ORF ( NP_073153, 1841 a.a. - 1944 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of the anaphase-promoting complex. This complex is an E3 ubiquitin ligase that regulates progression through the metaphase to anaphase portion of the cell cycle by ubiquitinating proteins which targets them for degradation. [provided by RefSeq, Dec 2011]
Molecular Mass : 37.18 kDa
AA Sequence : NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANAPC1 anaphase promoting complex subunit 1 [ Homo sapiens ]
Official Symbol ANAPC1
Synonyms ANAPC1; anaphase promoting complex subunit 1; anaphase-promoting complex subunit 1; APC1; MCPR; TSG24; cyclosome subunit 1; mitotic checkpoint regulator; testis-specific gene 24 protein; anaphase-promoting complex 1 (meiotic checkpoint regulator);
Gene ID 64682
mRNA Refseq NM_022662
Protein Refseq NP_073153
MIM 608473
UniProt ID Q9H1A4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC1 Products

Required fields are marked with *

My Review for All ANAPC1 Products

Required fields are marked with *

0
cart-icon