Recombinant Human ANAPC11 protein, GST-tagged
| Cat.No. : | ANAPC11-542H |
| Product Overview : | Human ANAPC11 full-length ORF ( AAH00607, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANAPC11 (Anaphase Promoting Complex Subunit 11) is a Protein Coding gene. Among its related pathways are HTLV-I infection and Activation of cAMP-Dependent PKA. GO annotations related to this gene include ubiquitin-protein transferase activity and ubiquitin-ubiquitin ligase activity. |
| Molecular Mass : | 31.68 kDa |
| AA Sequence : | MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANAPC11 anaphase promoting complex subunit 11 [ Homo sapiens ] |
| Official Symbol | ANAPC11 |
| Synonyms | ANAPC11; anaphase promoting complex subunit 11; anaphase promoting complex subunit 11 (yeast APC11 homolog); anaphase-promoting complex subunit 11; APC11; Apc11p; HSPC214; MGC882; cyclosome subunit 11; APC11 anaphase promoting complex subunit 11 homolog; hepatocellular carcinoma-associated RING finger protein; |
| Gene ID | 51529 |
| mRNA Refseq | NM_001002244 |
| Protein Refseq | NP_001002244 |
| MIM | 614534 |
| UniProt ID | Q9NYG5 |
| ◆ Recombinant Proteins | ||
| ANAPC11-1287HF | Recombinant Full Length Human ANAPC11 Protein, GST-tagged | +Inquiry |
| ANAPC11-5685Z | Recombinant Zebrafish ANAPC11 | +Inquiry |
| ANAPC11-318R | Recombinant Rhesus monkey ANAPC11 Protein, His-tagged | +Inquiry |
| Anapc11-1620M | Recombinant Mouse Anapc11 Protein, Myc/DDK-tagged | +Inquiry |
| ANAPC11-542H | Recombinant Human ANAPC11 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANAPC11-8868HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
| ANAPC11-8869HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
| ANAPC11-8870HCL | Recombinant Human ANAPC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC11 Products
Required fields are marked with *
My Review for All ANAPC11 Products
Required fields are marked with *
