Recombinant Human ANAPC11 protein, GST-tagged

Cat.No. : ANAPC11-542H
Product Overview : Human ANAPC11 full-length ORF ( AAH00607, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANAPC11 (Anaphase Promoting Complex Subunit 11) is a Protein Coding gene. Among its related pathways are HTLV-I infection and Activation of cAMP-Dependent PKA. GO annotations related to this gene include ubiquitin-protein transferase activity and ubiquitin-ubiquitin ligase activity.
Molecular Mass : 31.68 kDa
AA Sequence : MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANAPC11 anaphase promoting complex subunit 11 [ Homo sapiens ]
Official Symbol ANAPC11
Synonyms ANAPC11; anaphase promoting complex subunit 11; anaphase promoting complex subunit 11 (yeast APC11 homolog); anaphase-promoting complex subunit 11; APC11; Apc11p; HSPC214; MGC882; cyclosome subunit 11; APC11 anaphase promoting complex subunit 11 homolog; hepatocellular carcinoma-associated RING finger protein;
Gene ID 51529
mRNA Refseq NM_001002244
Protein Refseq NP_001002244
MIM 614534
UniProt ID Q9NYG5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC11 Products

Required fields are marked with *

My Review for All ANAPC11 Products

Required fields are marked with *

0
cart-icon
0
compare icon