Recombinant Human ANAPC13 protein, His-tagged

Cat.No. : ANAPC13-543H
Product Overview : Human ANAPC13 (NP_056206, 1 a.a. - 74 a.a.? ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq, Nov 2008]
Form : Liquid
Molecular Mass : 10 kDa
AA Sequence : MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
Purity : > 90% by SDS - PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT, 0.1M NaCl).
Gene Name ANAPC13 anaphase promoting complex subunit 13 [ Homo sapiens ]
Official Symbol ANAPC13
Synonyms ANAPC13; anaphase promoting complex subunit 13; anaphase-promoting complex subunit 13; APC13; DKFZP566D193; SWM1; cyclosome subunit 13; DKFZp566D193;
Gene ID 25847
mRNA Refseq NM_001242374
Protein Refseq NP_001229303
MIM 614484
UniProt ID Q9BS18

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANAPC13 Products

Required fields are marked with *

My Review for All ANAPC13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon