Recombinant Human ANAPC4 protein, GST-tagged

• Cat.No.: ANAPC4-545H
• Product Overview: Human ANAPC4 partial ORF ( AAH59383, 651 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The exact function of this gene product is not known. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
• Molecular Mass: 36.63 kDa
• AA Sequence: VVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANAPC4 anaphase promoting complex subunit 4 [ Homo sapiens ]
• Official Symbol: ANAPC4
• Synonyms: ANAPC4; anaphase promoting complex subunit 4; anaphase-promoting complex subunit 4; APC4; cyclosome subunit 4
• Gene ID: 29945
• mRNA Refseq: NM_013367
• Protein Refseq: NP_037499
• MIM: 606947
• UniProt ID: Q9UJX5