Recombinant Human ANAPC4 protein, GST-tagged
Cat.No. : | ANAPC4-545H |
Product Overview : | Human ANAPC4 partial ORF ( AAH59383, 651 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The exact function of this gene product is not known. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANAPC4 anaphase promoting complex subunit 4 [ Homo sapiens ] |
Official Symbol | ANAPC4 |
Synonyms | ANAPC4; anaphase promoting complex subunit 4; anaphase-promoting complex subunit 4; APC4; cyclosome subunit 4; |
Gene ID | 29945 |
mRNA Refseq | NM_013367 |
Protein Refseq | NP_037499 |
MIM | 606947 |
UniProt ID | Q9UJX5 |
◆ Recombinant Proteins | ||
ANAPC4-1887Z | Recombinant Zebrafish ANAPC4 | +Inquiry |
ANAPC4-545H | Recombinant Human ANAPC4 protein, GST-tagged | +Inquiry |
ANAPC4-323R | Recombinant Rhesus monkey ANAPC4 Protein, His-tagged | +Inquiry |
ANAPC4-151R | Recombinant Rhesus Macaque ANAPC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC4-73HCL | Recombinant Human ANAPC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC4 Products
Required fields are marked with *
My Review for All ANAPC4 Products
Required fields are marked with *