Recombinant Human ANGEL2 protein, GST-tagged
| Cat.No. : | ANGEL2-549H |
| Product Overview : | Human ANGEL2 full-length ORF ( AAH47469.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANGEL2 (Angel Homolog 2) is a Protein Coding gene. An important paralog of this gene is ANGEL1. |
| Molecular Mass : | 58.8 kDa |
| AA Sequence : | MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANGEL2 angel homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | ANGEL2 |
| Synonyms | ANGEL2; angel homolog 2 (Drosophila); protein angel homolog 2; FLJ12793; KIAA0759L; |
| Gene ID | 90806 |
| mRNA Refseq | NM_144567 |
| Protein Refseq | NP_653168 |
| UniProt ID | Q5VTE6 |
| ◆ Recombinant Proteins | ||
| Angel2-1625M | Recombinant Mouse Angel2 Protein, Myc/DDK-tagged | +Inquiry |
| ANGEL2-2081H | Recombinant Human ANGEL2 Protein, MYC/DDK-tagged | +Inquiry |
| ANGEL2-3188Z | Recombinant Zebrafish ANGEL2 | +Inquiry |
| ANGEL2-2727C | Recombinant Chicken ANGEL2 | +Inquiry |
| ANGEL2-549H | Recombinant Human ANGEL2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANGEL2-21HCL | Recombinant Human ANGEL2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGEL2 Products
Required fields are marked with *
My Review for All ANGEL2 Products
Required fields are marked with *
