Recombinant Human ANGPT2 protein, His-tagged
Cat.No. : | ANGPT2-3075H |
Product Overview : | Recombinant Human ANGPT2 protein(174-318 aa), fused to His tag, was expressed in E. coli. |
Availability | September 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 174-318 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ANGPT2 angiopoietin 2 [ Homo sapiens ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2; |
Gene ID | 285 |
mRNA Refseq | NM_001118887 |
Protein Refseq | NP_001112359 |
MIM | 601922 |
UniProt ID | O15123 |
◆ Recombinant Proteins | ||
ANGPT2-55H | Recombinant Human ANGPT2 | +Inquiry |
ANGPT2-245H | Recombinant Human ANGPT2(Lys275-Phe496) Protein, C-6*His-tagged | +Inquiry |
Angpt2-5309M | Recombinant Mouse Angpt2 protein, His-tagged | +Inquiry |
Angpt2-533M | Recombinant Mouse Angpt2 protein, His-tagged | +Inquiry |
Ang-2-3456H | Recombinant Human Ang-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *