Recombinant Human ANGPTL1 Protein, His tagged
Cat.No. : | ANGPTL1-001H |
Product Overview : | Recombinant Human ANGPTL1 Protein (39-491 aa) with C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 39-491 aa |
Description : | Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro. |
Source : | HEK293 |
Species : | Human |
Tag : | C-His |
Molecular Weight : | 53 kDa |
AA Sequence : | ATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPIDHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.0, 10% Glycerol, 8% Trehalose |
Concentration : | 1 mg/mL by Bradford |
Gene Name | ANGPTL1 angiopoietin-like 1 [ Homo sapiens (human) ] |
Official Symbol | ANGPTL1 |
Synonyms | ANGPTL1; angiopoietin-like 1; ANGPT3; angiopoietin-related protein 1; ANG3; angioarrestin; AngY; ARP1; ANG-3; angiopoietin 3; angiopoietin-3; angiopoietin Y1; angiopoietin-like protein 1; dJ595C2.2 (angiopoietin Y1); UNQ162; dJ595C2.2; KIAA0351 |
Gene ID | 9068 |
mRNA Refseq | NM_004673 |
Protein Refseq | NP_004664 |
MIM | 603874 |
UniProt ID | O95841 |
◆ Recombinant Proteins | ||
Angptl1-7869R | Recombinant Rat Angptl1 protein, His & T7-tagged | +Inquiry |
ANGPTL1-26572TH | Recombinant Human ANGPTL1, FLAG-tagged | +Inquiry |
ANGPTL1-001H | Recombinant Human ANGPTL1 Protein, His tagged | +Inquiry |
ANGPTL1-7867H | Recombinant Human ANGPTL1 protein, His-tagged | +Inquiry |
Angptl1-7868M | Recombinant Mouse Angptl1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL1-001CCL | Recombinant Canine ANGPTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL1 Products
Required fields are marked with *
My Review for All ANGPTL1 Products
Required fields are marked with *
0
Inquiry Basket