Recombinant Human ANGPTL6 protein, GST-tagged
Cat.No. : | ANGPTL6-559H |
Product Overview : | Human ANGPTL6 partial ORF (NP_114123, 211 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANGPTL6 (Angiopoietin Like 6) is a Protein Coding gene. Diseases associated with ANGPTL6 include Gnathomiasis and Enterobiasis. Among its related pathways are Activation of cAMP-Dependent PKA and GPCR Pathway. An important paralog of this gene is ANGPTL2. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANGPTL6 angiopoietin-like 6 [ Homo sapiens ] |
Official Symbol | ANGPTL6 |
Synonyms | ANGPTL6; angiopoietin-like 6; angiopoietin-related protein 6; AGF; angiopoietin related protein 5; ARP5; angiopoietin-like protein 6; angiopoietin-related protein 5; angiopoietin-related growth factor; |
Gene ID | 83854 |
mRNA Refseq | NM_031917 |
Protein Refseq | NP_114123 |
MIM | 609336 |
UniProt ID | Q8NI99 |
◆ Recombinant Proteins | ||
ANGPTL6-531M | Recombinant Mouse ANGPTL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL6-559H | Recombinant Human ANGPTL6 protein, GST-tagged | +Inquiry |
ANGPTL6-26577TH | Recombinant Human ANGPTL6, FLAG-tagged | +Inquiry |
ANGPTL6-26346TH | Recombinant Human ANGPTL6, FLAG-tagged | +Inquiry |
ANGPTL6-1641M | Recombinant Mouse ANGPTL6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL6 Products
Required fields are marked with *
My Review for All ANGPTL6 Products
Required fields are marked with *