Recombinant Human ANGPTL7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ANGPTL7-1782H
Product Overview : ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure. Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency.
Molecular Mass : 40 kDa
AA Sequence : MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ANGPTL7 angiopoietin-like 7 [ Homo sapiens (human) ]
Official Symbol ANGPTL7
Synonyms ANGPTL7; angiopoietin-like 7; angiopoietin-related protein 7; AngX; CDT6; angiopoietin-like protein 7; angiopoietin-like factor (CDT6); cornea-derived transcript 6 protein; dJ647M16.1; RP4-647M16.2;
Gene ID 10218
mRNA Refseq NM_021146
Protein Refseq NP_066969
MIM 618517
UniProt ID O43827

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPTL7 Products

Required fields are marked with *

My Review for All ANGPTL7 Products

Required fields are marked with *

0
cart-icon
0
compare icon