Recombinant Human ANKRD1 protein, T7/His-tagged

Cat.No. : ANKRD1-235H
Product Overview : Recombinant human ANKRD1 cDNA (2–319 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-319 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKT LLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVP TFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGG NLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLI MYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ANKRD1 ankyrin repeat domain 1 (cardiac muscle) [ Homo sapiens ]
Official Symbol ANKRD1
Synonyms ANKRD1; ankyrin repeat domain 1 (cardiac muscle); ankyrin repeat domain-containing protein 1; ALRP; C 193; CARP; CVARP; MCARP; liver ankyrin repeat domain 1; cardiac ankyrin repeat protein; cytokine-inducible nuclear protein; cytokine-inducible gene C-193 protein; C-193; bA320F15.2;
Gene ID 27063
mRNA Refseq NM_014391
Protein Refseq NP_055206
MIM 609599
UniProt ID Q15327
Chromosome Location 10q23.33
Pathway Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem;
Function DNA binding; R-SMAD binding; RNA polymerase II transcription coactivator activity; RNA polymerase II transcription factor binding; histone deacetylase binding; p53 binding; protein binding; titin binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD1 Products

Required fields are marked with *

My Review for All ANKRD1 Products

Required fields are marked with *

0
cart-icon