Recombinant Human ANKRD1 protein, T7/His-tagged
Cat.No. : | ANKRD1-235H |
Product Overview : | Recombinant human ANKRD1 cDNA (2–319 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-319 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKT LLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVP TFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGG NLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLI MYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | ANKRD1 ankyrin repeat domain 1 (cardiac muscle) [ Homo sapiens ] |
Official Symbol | ANKRD1 |
Synonyms | ANKRD1; ankyrin repeat domain 1 (cardiac muscle); ankyrin repeat domain-containing protein 1; ALRP; C 193; CARP; CVARP; MCARP; liver ankyrin repeat domain 1; cardiac ankyrin repeat protein; cytokine-inducible nuclear protein; cytokine-inducible gene C-193 protein; C-193; bA320F15.2; |
Gene ID | 27063 |
mRNA Refseq | NM_014391 |
Protein Refseq | NP_055206 |
MIM | 609599 |
UniProt ID | Q15327 |
Chromosome Location | 10q23.33 |
Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Hypertrophy Model, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
Function | DNA binding; R-SMAD binding; RNA polymerase II transcription coactivator activity; RNA polymerase II transcription factor binding; histone deacetylase binding; p53 binding; protein binding; titin binding; transcription corepressor activity; |
◆ Recombinant Proteins | ||
ANKRD1-235H | Recombinant Human ANKRD1 protein, T7/His-tagged | +Inquiry |
ANKRD1-570H | Recombinant Human ANKRD1 protein, GST-tagged | +Inquiry |
ANKRD1-7150H | Recombinant Human Ankyrin Repeat Domain 1 (Cardiac Muscle), His-tagged | +Inquiry |
ANKRD1-586H | Recombinant Human ANKRD1 Protein, His-tagged | +Inquiry |
ANKRD1-673R | Recombinant Rat ANKRD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD1-8858HCL | Recombinant Human ANKRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD1 Products
Required fields are marked with *
My Review for All ANKRD1 Products
Required fields are marked with *