Recombinant Human ANKRD10 protein, GST-tagged
Cat.No. : | ANKRD10-571H |
Product Overview : | Human ANKRD10 full-length ORF ( AAH01727.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD10 (Ankyrin Repeat Domain 10) is a Protein Coding gene. An important paralog of this gene is ANKRD37. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLECISALVANGAHVEFISQSSVHSCLPGELQHGVTFDPSVLIQCLKPEKCQWPDSSRHCTNPGFPRVCPVSLEPPELSSEPFL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD10 ankyrin repeat domain 10 [ Homo sapiens ] |
Official Symbol | ANKRD10 |
Synonyms | Ankrd10; Ankyrin repeat domain-containing protein 10; ANR10_HUMAN; RP11-120J20.3; ANKRD10 |
Gene ID | 55608 |
mRNA Refseq | NM_017664.2 |
Protein Refseq | NP_060134.2 |
UniProt ID | Q9NXR5 |
◆ Recombinant Proteins | ||
ANKRD10-157R | Recombinant Rhesus Macaque ANKRD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD10-329R | Recombinant Rhesus monkey ANKRD10 Protein, His-tagged | +Inquiry |
ANKRD10-9115H | Recombinant Human ANKRD10 protein, GST-tagged | +Inquiry |
ANKRD10-9664H | Recombinant Human ANKRD10 protein, His-tagged | +Inquiry |
ANKRD10-571H | Recombinant Human ANKRD10 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD10-8857HCL | Recombinant Human ANKRD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD10 Products
Required fields are marked with *
My Review for All ANKRD10 Products
Required fields are marked with *