Recombinant Human ANKRD29 protein, GST-tagged
Cat.No. : | ANKRD29-587H |
Product Overview : | Human ANKRD29 full-length ORF (BAC85555.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD29 (Ankyrin Repeat Domain 29) is a Protein Coding gene. An important paralog of this gene is KIDINS220. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MVAAYAGHIDCVRELVLQGADINLQREDGGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRTGQRPCGSRPRWATARWCGCCCCAEPTATLRGTMAQQHY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD29 ankyrin repeat domain 29 [ Homo sapiens ] |
Official Symbol | ANKRD29 |
Synonyms | ANKRD29; ankyrin repeat domain 29; ankyrin repeat domain-containing protein 29 |
Gene ID | 147463 |
mRNA Refseq | NM_173505.2 |
Protein Refseq | NP_775776.2 |
UniProt ID | Q8N6D5 |
◆ Recombinant Proteins | ||
ANKRD29-1381HF | Recombinant Full Length Human ANKRD29 Protein, GST-tagged | +Inquiry |
ANKRD29-5178H | Recombinant Human ANKRD29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD29-587H | Recombinant Human ANKRD29 protein, GST-tagged | +Inquiry |
ANKRD29-2900Z | Recombinant Zebrafish ANKRD29 | +Inquiry |
Ankrd29-1633M | Recombinant Mouse Ankrd29 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD29-8852HCL | Recombinant Human ANKRD29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD29 Products
Required fields are marked with *
My Review for All ANKRD29 Products
Required fields are marked with *