Recombinant Human ANKRD29 protein, GST-tagged

Cat.No. : ANKRD29-587H
Product Overview : Human ANKRD29 full-length ORF (BAC85555.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD29 (Ankyrin Repeat Domain 29) is a Protein Coding gene. An important paralog of this gene is KIDINS220.
Molecular Mass : 40.5 kDa
AA Sequence : MVAAYAGHIDCVRELVLQGADINLQREDGGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRTGQRPCGSRPRWATARWCGCCCCAEPTATLRGTMAQQHY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD29 ankyrin repeat domain 29 [ Homo sapiens ]
Official Symbol ANKRD29
Synonyms ANKRD29; ankyrin repeat domain 29; ankyrin repeat domain-containing protein 29
Gene ID 147463
mRNA Refseq NM_173505.2
Protein Refseq NP_775776.2
UniProt ID Q8N6D5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD29 Products

Required fields are marked with *

My Review for All ANKRD29 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon