Recombinant Human ANKRD30A protein, GST-tagged

• Cat.No.: ANKRD30A-588H
• Product Overview: Human ANKRD30A partial ORF ( NP_443723, 948 a.a. - 1055 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a DNA-binding transcription factor that is uniquely expressed in mammary epithelium and the testis. Altered expression levels have been associated with breast cancer progression. [provided by RefSeq, Nov 2016]
• Molecular Mass: 37.62 kDa
• AA Sequence: SEAKEIKSQLENQKVKWEQELCSVRLTLNQEEEKRRNADILNEKIREELGRIEEQHRKELEVKQQLEQALRIQDIELKSVESNLNQVSHTHENENYLLHENCMLKKEI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD30A ankyrin repeat domain 30A [ Homo sapiens ]
• Official Symbol: ANKRD30A
• Synonyms: ANKRD30A; ankyrin repeat domain 30A; ankyrin repeat domain-containing protein 30A; breast cancer antigen NY BR 1; NY BR 1; breast cancer antigen NY-BR-1; serologically defined breast cancer antigen NY-BR-1; NY-BR-1; RP11-20F24.1
• Gene ID: 91074
• mRNA Refseq: NM_052997
• Protein Refseq: NP_443723
• MIM: 610856
• UniProt ID: Q9BXX3