Recombinant Human ANKRD30A protein, GST-tagged
| Cat.No. : | ANKRD30A-588H |
| Product Overview : | Human ANKRD30A partial ORF ( NP_443723, 948 a.a. - 1055 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a DNA-binding transcription factor that is uniquely expressed in mammary epithelium and the testis. Altered expression levels have been associated with breast cancer progression. [provided by RefSeq, Nov 2016] |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | SEAKEIKSQLENQKVKWEQELCSVRLTLNQEEEKRRNADILNEKIREELGRIEEQHRKELEVKQQLEQALRIQDIELKSVESNLNQVSHTHENENYLLHENCMLKKEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD30A ankyrin repeat domain 30A [ Homo sapiens ] |
| Official Symbol | ANKRD30A |
| Synonyms | ANKRD30A; ankyrin repeat domain 30A; ankyrin repeat domain-containing protein 30A; breast cancer antigen NY BR 1; NY BR 1; breast cancer antigen NY-BR-1; serologically defined breast cancer antigen NY-BR-1; NY-BR-1; RP11-20F24.1; |
| Gene ID | 91074 |
| mRNA Refseq | NM_052997 |
| Protein Refseq | NP_443723 |
| MIM | 610856 |
| UniProt ID | Q9BXX3 |
| ◆ Recombinant Proteins | ||
| ANKRD30A-588H | Recombinant Human ANKRD30A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD30A Products
Required fields are marked with *
My Review for All ANKRD30A Products
Required fields are marked with *
