Recombinant Human ANKRD32 protein, GST-tagged
| Cat.No. : | ANKRD32-589H |
| Product Overview : | Human ANKRD32 full-length ORF ( NP_115666.1, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SLF1 (SMC5-SMC6 Complex Localization Factor 1) is a Protein Coding gene. An important paralog of this gene is BCOR. |
| Molecular Mass : | 73.5 kDa |
| AA Sequence : | MGRNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLSRMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD32 ankyrin repeat domain 32 [ Homo sapiens ] |
| Official Symbol | ANKRD32 |
| Synonyms | ANKRD32; ankyrin repeat domain 32; BRCT domain containing 1 , BRCTD1; ankyrin repeat domain-containing protein 32; DKFZp564C0469; DKFZp761C121; BRCT domain containing 1; BRCT domain-containing protein 1; BRCTx; BRCTD1; |
| Gene ID | 84250 |
| mRNA Refseq | NM_032290 |
| Protein Refseq | NP_115666 |
| UniProt ID | Q9BQI6 |
| ◆ Recombinant Proteins | ||
| ANKRD32-3478B | Recombinant Bovine ANKRD32, His-tagged | +Inquiry |
| ANKRD32-1477HF | Recombinant Full Length Human ANKRD32 Protein, GST-tagged | +Inquiry |
| ANKRD32-546M | Recombinant Mouse ANKRD32 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANKRD32-1665M | Recombinant Mouse ANKRD32 Protein | +Inquiry |
| ANKRD32-589H | Recombinant Human ANKRD32 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD32 Products
Required fields are marked with *
My Review for All ANKRD32 Products
Required fields are marked with *
