Recombinant Human ANKRD32 protein, GST-tagged

• Cat.No.: ANKRD32-589H
• Product Overview: Human ANKRD32 full-length ORF ( NP_115666.1, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SLF1 (SMC5-SMC6 Complex Localization Factor 1) is a Protein Coding gene. An important paralog of this gene is BCOR.
• Molecular Mass: 73.5 kDa
• AA Sequence: MGRNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLSRMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD32 ankyrin repeat domain 32 [ Homo sapiens ]
• Official Symbol: ANKRD32
• Synonyms: ANKRD32; ankyrin repeat domain 32; BRCT domain containing 1 , BRCTD1; ankyrin repeat domain-containing protein 32; DKFZp564C0469; DKFZp761C121; BRCT domain containing 1; BRCT domain-containing protein 1; BRCTx; BRCTD1
• Gene ID: 84250
• mRNA Refseq: NM_032290
• Protein Refseq: NP_115666
• UniProt ID: Q9BQI6