Recombinant Human ANKRD32 protein, GST-tagged
Cat.No. : | ANKRD32-589H |
Product Overview : | Human ANKRD32 full-length ORF ( NP_115666.1, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SLF1 (SMC5-SMC6 Complex Localization Factor 1) is a Protein Coding gene. An important paralog of this gene is BCOR. |
Molecular Mass : | 73.5 kDa |
AA Sequence : | MGRNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLSRMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD32 ankyrin repeat domain 32 [ Homo sapiens ] |
Official Symbol | ANKRD32 |
Synonyms | ANKRD32; ankyrin repeat domain 32; BRCT domain containing 1 , BRCTD1; ankyrin repeat domain-containing protein 32; DKFZp564C0469; DKFZp761C121; BRCT domain containing 1; BRCT domain-containing protein 1; BRCTx; BRCTD1; |
Gene ID | 84250 |
mRNA Refseq | NM_032290 |
Protein Refseq | NP_115666 |
UniProt ID | Q9BQI6 |
◆ Recombinant Proteins | ||
ANKRD32-3478B | Recombinant Bovine ANKRD32, His-tagged | +Inquiry |
ANKRD32-1665M | Recombinant Mouse ANKRD32 Protein | +Inquiry |
ANKRD32-589H | Recombinant Human ANKRD32 protein, GST-tagged | +Inquiry |
ANKRD32-1477HF | Recombinant Full Length Human ANKRD32 Protein, GST-tagged | +Inquiry |
ANKRD32-546M | Recombinant Mouse ANKRD32 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD32 Products
Required fields are marked with *
My Review for All ANKRD32 Products
Required fields are marked with *
0
Inquiry Basket