Recombinant Human ANKRD32 protein, GST-tagged

Cat.No. : ANKRD32-589H
Product Overview : Human ANKRD32 full-length ORF ( NP_115666.1, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SLF1 (SMC5-SMC6 Complex Localization Factor 1) is a Protein Coding gene. An important paralog of this gene is BCOR.
Molecular Mass : 73.5 kDa
AA Sequence : MGRNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMVYSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRTLLMLNGTKQKQVEGLPELLDLNLAKCSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFHYQQLEFGSFLLSRMLLNFCSIFDLSSEFILASKGLTHLNELLMACKSHKETTSVHTDWLLDLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMITLEMMCRSVMEFS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD32 ankyrin repeat domain 32 [ Homo sapiens ]
Official Symbol ANKRD32
Synonyms ANKRD32; ankyrin repeat domain 32; BRCT domain containing 1 , BRCTD1; ankyrin repeat domain-containing protein 32; DKFZp564C0469; DKFZp761C121; BRCT domain containing 1; BRCT domain-containing protein 1; BRCTx; BRCTD1;
Gene ID 84250
mRNA Refseq NM_032290
Protein Refseq NP_115666
UniProt ID Q9BQI6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD32 Products

Required fields are marked with *

My Review for All ANKRD32 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon