Recombinant Human ANKRD37 protein, His-tagged
Cat.No. : | ANKRD37-2578H |
Product Overview : | Recombinant Human ANKRD37 protein(1-158 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-158 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ANKRD37 ankyrin repeat domain 37 [ Homo sapiens ] |
Official Symbol | ANKRD37 |
Synonyms | ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507; |
Gene ID | 353322 |
mRNA Refseq | NM_181726 |
Protein Refseq | NP_859077 |
UniProt ID | Q7Z713 |
◆ Recombinant Proteins | ||
ANKRD37-7355Z | Recombinant Zebrafish ANKRD37 | +Inquiry |
ANKRD37-550M | Recombinant Mouse ANKRD37 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD37-376H | Recombinant Human ANKRD37 Protein, His-tagged | +Inquiry |
ANKRD37-1309HF | Recombinant Full Length Human ANKRD37 Protein, GST-tagged | +Inquiry |
ANKRD37-2578H | Recombinant Human ANKRD37 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD37-8851HCL | Recombinant Human ANKRD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD37 Products
Required fields are marked with *
My Review for All ANKRD37 Products
Required fields are marked with *