"ANKRD39" Related Products

Recombinant Human ANKRD39 protein, GST-tagged

Cat.No.: ANKRD39-596H
Product Overview: Human ANKRD39 full-length ORF ( NP_057550.2, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
Description: ANKRD39 (Ankyrin Repeat Domain 39) is a Protein Coding gene. An important paralog of this gene is GABPB1.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 46.1 kDa
AA Sequence: MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEITRLLLSHGSNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: ANKRD39 ankyrin repeat domain 39 [ Homo sapiens ]
Official Symbol: ANKRD39
Synonyms: ANKRD39; ankyrin repeat domain 39; ankyrin repeat domain-containing protein 39; MGC41816;
Gene ID: 51239
mRNA Refseq: NM_016466
Protein Refseq: NP_057550
UniProt ID: Q53RE8

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.