Recombinant Human ANKRD39 protein, GST-tagged
Cat.No. : | ANKRD39-596H |
Product Overview : | Human ANKRD39 full-length ORF ( NP_057550.2, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD39 (Ankyrin Repeat Domain 39) is a Protein Coding gene. An important paralog of this gene is GABPB1. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEITRLLLSHGSNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD39 ankyrin repeat domain 39 [ Homo sapiens ] |
Official Symbol | ANKRD39 |
Synonyms | ANKRD39; ankyrin repeat domain 39; ankyrin repeat domain-containing protein 39; MGC41816; |
Gene ID | 51239 |
mRNA Refseq | NM_016466 |
Protein Refseq | NP_057550 |
UniProt ID | Q53RE8 |
◆ Recombinant Proteins | ||
ANKRD39-6355Z | Recombinant Zebrafish ANKRD39 | +Inquiry |
ANKRD39-1275HF | Recombinant Full Length Human ANKRD39 Protein, GST-tagged | +Inquiry |
Ankrd39-419M | Recombinant Mouse Ankrd39 Protein, MYC/DDK-tagged | +Inquiry |
ANKRD39-5892H | Recombinant Human ANKRD39 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD39-596H | Recombinant Human ANKRD39 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD39-8850HCL | Recombinant Human ANKRD39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD39 Products
Required fields are marked with *
My Review for All ANKRD39 Products
Required fields are marked with *
0
Inquiry Basket