Recombinant Human ANKRD39 protein, GST-tagged

Cat.No. : ANKRD39-596H
Product Overview : Human ANKRD39 full-length ORF ( NP_057550.2, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD39 (Ankyrin Repeat Domain 39) is a Protein Coding gene. An important paralog of this gene is GABPB1.
Molecular Mass : 46.1 kDa
AA Sequence : MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEITRLLLSHGSNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD39 ankyrin repeat domain 39 [ Homo sapiens ]
Official Symbol ANKRD39
Synonyms ANKRD39; ankyrin repeat domain 39; ankyrin repeat domain-containing protein 39; MGC41816;
Gene ID 51239
mRNA Refseq NM_016466
Protein Refseq NP_057550
UniProt ID Q53RE8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD39 Products

Required fields are marked with *

My Review for All ANKRD39 Products

Required fields are marked with *

0
cart-icon
0
compare icon