Recombinant Human ANKRD42 protein, GST-tagged

• Cat.No.: ANKRD42-598H
• Product Overview: Human ANKRD42 full-length ORF (BAC04496.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD42 (Ankyrin Repeat Domain 42) is a Protein Coding gene. GO annotations related to this gene include structural constituent of ribosome and NF-kappaB binding. An important paralog of this gene is ESPNL.
• Molecular Mass: 69.4 kDa
• AA Sequence: MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD42 ankyrin repeat domain 42 [ Homo sapiens ]
• Official Symbol: ANKRD42
• Synonyms: ANKRD42; ankyrin repeat domain 42; ankyrin repeat domain-containing protein 42; FLJ37874; SARP; several ankyrin repeat protein
• Gene ID: 338699
• mRNA Refseq: NM_182603
• Protein Refseq: NP_872409
• UniProt ID: Q8N9B4