Recombinant Human ANKRD42 protein, GST-tagged
Cat.No. : | ANKRD42-598H |
Product Overview : | Human ANKRD42 full-length ORF (BAC04496.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD42 (Ankyrin Repeat Domain 42) is a Protein Coding gene. GO annotations related to this gene include structural constituent of ribosome and NF-kappaB binding. An important paralog of this gene is ESPNL. |
Molecular Mass : | 69.4 kDa |
AA Sequence : | MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD42 ankyrin repeat domain 42 [ Homo sapiens ] |
Official Symbol | ANKRD42 |
Synonyms | ANKRD42; ankyrin repeat domain 42; ankyrin repeat domain-containing protein 42; FLJ37874; SARP; several ankyrin repeat protein; |
Gene ID | 338699 |
mRNA Refseq | NM_182603 |
Protein Refseq | NP_872409 |
UniProt ID | Q8N9B4 |
◆ Recombinant Proteins | ||
ANKRD42-1446HF | Recombinant Full Length Human ANKRD42 Protein, GST-tagged | +Inquiry |
ANKRD42-598H | Recombinant Human ANKRD42 protein, GST-tagged | +Inquiry |
ANKRD42-552M | Recombinant Mouse ANKRD42 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD42-1676M | Recombinant Mouse ANKRD42 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD42 Products
Required fields are marked with *
My Review for All ANKRD42 Products
Required fields are marked with *
0
Inquiry Basket