Recombinant Human ANKRD42 protein, GST-tagged

Cat.No. : ANKRD42-598H
Product Overview : Human ANKRD42 full-length ORF (BAC04496.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD42 (Ankyrin Repeat Domain 42) is a Protein Coding gene. GO annotations related to this gene include structural constituent of ribosome and NF-kappaB binding. An important paralog of this gene is ESPNL.
Molecular Mass : 69.4 kDa
AA Sequence : MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASHIAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVEGSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD42 ankyrin repeat domain 42 [ Homo sapiens ]
Official Symbol ANKRD42
Synonyms ANKRD42; ankyrin repeat domain 42; ankyrin repeat domain-containing protein 42; FLJ37874; SARP; several ankyrin repeat protein;
Gene ID 338699
mRNA Refseq NM_182603
Protein Refseq NP_872409
UniProt ID Q8N9B4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD42 Products

Required fields are marked with *

My Review for All ANKRD42 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon