Recombinant Human ANKRD46 protein, GST-tagged
| Cat.No. : | ANKRD46-301490H |
| Product Overview : | Recombinant Human ANKRD46 (1-189 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Asp189 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ANKRD46 ankyrin repeat domain 46 [ Homo sapiens ] |
| Official Symbol | ANKRD46 |
| Synonyms | ANK-S; GENX-115279 |
| Gene ID | 157567 |
| mRNA Refseq | NM_198401.3 |
| Protein Refseq | NP_940683.1 |
| UniProt ID | Q86W74 |
| ◆ Recombinant Proteins | ||
| RFL26776PF | Recombinant Full Length Pongo Abelii Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged | +Inquiry |
| ANKRD46-46C | Recombinant Cynomolgus Monkey ANKRD46 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANKRD46-301490H | Recombinant Human ANKRD46 protein, GST-tagged | +Inquiry |
| ANKRD46-676R | Recombinant Rat ANKRD46 Protein | +Inquiry |
| ANKRD46-554M | Recombinant Mouse ANKRD46 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD46 Products
Required fields are marked with *
My Review for All ANKRD46 Products
Required fields are marked with *



