Recombinant Human ANKRD46 protein, GST-tagged
Cat.No. : | ANKRD46-301490H |
Product Overview : | Recombinant Human ANKRD46 (1-189 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asp189 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ANKRD46 ankyrin repeat domain 46 [ Homo sapiens ] |
Official Symbol | ANKRD46 |
Synonyms | ANK-S; GENX-115279 |
Gene ID | 157567 |
mRNA Refseq | NM_198401.3 |
Protein Refseq | NP_940683.1 |
UniProt ID | Q86W74 |
◆ Recombinant Proteins | ||
ANKRD46-1678M | Recombinant Mouse ANKRD46 Protein | +Inquiry |
RFL26776PF | Recombinant Full Length Pongo Abelii Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged | +Inquiry |
ANKRD46-676R | Recombinant Rat ANKRD46 Protein | +Inquiry |
ANKRD46-331R | Recombinant Rhesus monkey ANKRD46 Protein, His-tagged | +Inquiry |
RFL12793RF | Recombinant Full Length Rat Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKRD46 Products
Required fields are marked with *
My Review for All ANKRD46 Products
Required fields are marked with *
0
Inquiry Basket