Recombinant Human ANKRD49 protein, GST-tagged

Cat.No. : ANKRD49-601H
Product Overview : Human ANKRD49 full-length ORF ( NP_060174.2, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD49 (Ankyrin Repeat Domain 49) is a Protein Coding gene.
Molecular Mass : 53.7 kDa
AA Sequence : MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD49 ankyrin repeat domain 49 [ Homo sapiens ]
Official Symbol ANKRD49
Synonyms ANKRD49; ankyrin repeat domain 49; ankyrin repeat domain-containing protein 49; FGIF; FLJ20189; GBIF; fetal globin-inducing factor; FLJ20441;
Gene ID 54851
mRNA Refseq NM_017704
Protein Refseq NP_060174
UniProt ID Q8WVL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD49 Products

Required fields are marked with *

My Review for All ANKRD49 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon