Recombinant Human ANKRD49 protein, GST-tagged
Cat.No. : | ANKRD49-601H |
Product Overview : | Human ANKRD49 full-length ORF ( NP_060174.2, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD49 (Ankyrin Repeat Domain 49) is a Protein Coding gene. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD49 ankyrin repeat domain 49 [ Homo sapiens ] |
Official Symbol | ANKRD49 |
Synonyms | ANKRD49; ankyrin repeat domain 49; ankyrin repeat domain-containing protein 49; FGIF; FLJ20189; GBIF; fetal globin-inducing factor; FLJ20441; |
Gene ID | 54851 |
mRNA Refseq | NM_017704 |
Protein Refseq | NP_060174 |
UniProt ID | Q8WVL7 |
◆ Recombinant Proteins | ||
ANKRD49-332R | Recombinant Rhesus monkey ANKRD49 Protein, His-tagged | +Inquiry |
ANKRD49-601H | Recombinant Human ANKRD49 protein, GST-tagged | +Inquiry |
ANKRD49-1679M | Recombinant Mouse ANKRD49 Protein | +Inquiry |
Ankrd49-1638M | Recombinant Mouse Ankrd49 Protein, Myc/DDK-tagged | +Inquiry |
ANKRD49-2362Z | Recombinant Zebrafish ANKRD49 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD49-8848HCL | Recombinant Human ANKRD49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD49 Products
Required fields are marked with *
My Review for All ANKRD49 Products
Required fields are marked with *