Recombinant Human ANKRD53 protein, GST-tagged

• Cat.No.: ANKRD53-604H
• Product Overview: Human ANKRD53 full-length ORF ( ENSP00000272421, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD53 (Ankyrin Repeat Domain 53) is a Protein Coding gene.
• Molecular Mass: 64.6 kDa
• AA Sequence: MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPLPDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNVEWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEYQGQGCSVHFPFAFSPITPETLLWQDISLLSDCGFLWRRRELSF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD53 ankyrin repeat domain 53 [ Homo sapiens ]
• Official Symbol: ANKRD53
• Synonyms: ANKRD53; ankyrin repeat domain 53; ankyrin repeat domain-containing protein 53; FLJ12056; FLJ36160
• Gene ID: 79998
• mRNA Refseq: NM_001115116
• Protein Refseq: NP_001108588
• UniProt ID: Q8N9V6