Recombinant Human ANKRD53 protein, GST-tagged
Cat.No. : | ANKRD53-604H |
Product Overview : | Human ANKRD53 full-length ORF ( ENSP00000272421, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD53 (Ankyrin Repeat Domain 53) is a Protein Coding gene. |
Molecular Mass : | 64.6 kDa |
AA Sequence : | MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPLPDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNVEWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEYQGQGCSVHFPFAFSPITPETLLWQDISLLSDCGFLWRRRELSF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD53 ankyrin repeat domain 53 [ Homo sapiens ] |
Official Symbol | ANKRD53 |
Synonyms | ANKRD53; ankyrin repeat domain 53; ankyrin repeat domain-containing protein 53; FLJ12056; FLJ36160; |
Gene ID | 79998 |
mRNA Refseq | NM_001115116 |
Protein Refseq | NP_001108588 |
UniProt ID | Q8N9V6 |
◆ Recombinant Proteins | ||
ANKRD53-297C | Recombinant Cynomolgus ANKRD53 Protein, His-tagged | +Inquiry |
ANKRD53-1683M | Recombinant Mouse ANKRD53 Protein | +Inquiry |
ANKRD53-558M | Recombinant Mouse ANKRD53 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD53-47C | Recombinant Cynomolgus Monkey ANKRD53 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANKRD53-1326HF | Recombinant Full Length Human ANKRD53 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD53-8847HCL | Recombinant Human ANKRD53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD53 Products
Required fields are marked with *
My Review for All ANKRD53 Products
Required fields are marked with *
0
Inquiry Basket