Recombinant Human ANKRD54 protein, GST-tagged

Cat.No. : ANKRD54-605H
Product Overview : Human ANKRD54 full-length ORF (BAC87043.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD54 (Ankyrin Repeat Domain 54) is a Protein Coding gene. GO annotations related to this gene include protein complex binding and protein kinase regulator activity. An important paralog of this gene is ANKRD23.
Molecular Mass : 44.7 kDa
AA Sequence : MVLILTSEMGWGTRHCTWRPAPTTFLSSPHCYEEVCGFFPSLSSFSPSPPECSPQLVPAGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD54 ankyrin repeat domain 54 [ Homo sapiens ]
Official Symbol ANKRD54
Synonyms ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; LIAR;
Gene ID 129138
mRNA Refseq NM_138797
Protein Refseq NP_620152
MIM 613383
UniProt ID Q6NXT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD54 Products

Required fields are marked with *

My Review for All ANKRD54 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon