Recombinant Human ANKRD54 protein, GST-tagged
| Cat.No. : | ANKRD54-605H |
| Product Overview : | Human ANKRD54 full-length ORF (BAC87043.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANKRD54 (Ankyrin Repeat Domain 54) is a Protein Coding gene. GO annotations related to this gene include protein complex binding and protein kinase regulator activity. An important paralog of this gene is ANKRD23. |
| Molecular Mass : | 44.7 kDa |
| AA Sequence : | MVLILTSEMGWGTRHCTWRPAPTTFLSSPHCYEEVCGFFPSLSSFSPSPPECSPQLVPAGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD54 ankyrin repeat domain 54 [ Homo sapiens ] |
| Official Symbol | ANKRD54 |
| Synonyms | ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; LIAR; |
| Gene ID | 129138 |
| mRNA Refseq | NM_138797 |
| Protein Refseq | NP_620152 |
| MIM | 613383 |
| UniProt ID | Q6NXT1 |
| ◆ Recombinant Proteins | ||
| ANKRD54-696Z | Recombinant Zebrafish ANKRD54 | +Inquiry |
| ANKRD54-1439H | Recombinant Human ANKRD54 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ANKRD54-677R | Recombinant Rat ANKRD54 Protein | +Inquiry |
| ANKRD54-30143H | Recombinant Human ANKRD54 protein, GST-tagged | +Inquiry |
| ANKRD54-1344HF | Recombinant Full Length Human ANKRD54 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD54 Products
Required fields are marked with *
My Review for All ANKRD54 Products
Required fields are marked with *
