Recombinant Human ANKRD9 protein, GST-tagged
Cat.No. : | ANKRD9-609H |
Product Overview : | Human ANKRD9 full-length ORF ( NP_689539.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD9 (Ankyrin Repeat Domain 9) is a Protein Coding gene. |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD9 ankyrin repeat domain 9 [ Homo sapiens ] |
Official Symbol | ANKRD9 |
Synonyms | 2500003O20Rik; ANKR9_HUMAN; Ankrd9; Ankyrin repeat domain 9; Ankyrin repeat domain-containing protein 9; MGC21990; ANKRD9 |
Gene ID | 122416 |
mRNA Refseq | NM_152326.2 |
Protein Refseq | NP_689539.1 |
UniProt ID | Q96BM1 |
◆ Recombinant Proteins | ||
ANKRD9-9676H | Recombinant Human ANKRD9, His-tagged | +Inquiry |
ANKRD9-1689Z | Recombinant Zebrafish ANKRD9 | +Inquiry |
ANKRD9-609H | Recombinant Human ANKRD9 protein, GST-tagged | +Inquiry |
ANKRD9-1525HF | Recombinant Full Length Human ANKRD9 Protein, GST-tagged | +Inquiry |
ANKRD9-562M | Recombinant Mouse ANKRD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD9 Products
Required fields are marked with *
My Review for All ANKRD9 Products
Required fields are marked with *