Recombinant Human ANKRD9 protein, GST-tagged

Cat.No. : ANKRD9-609H
Product Overview : Human ANKRD9 full-length ORF ( NP_689539.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD9 (Ankyrin Repeat Domain 9) is a Protein Coding gene.
Molecular Mass : 60.7 kDa
AA Sequence : MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFHWDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALAVRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTPVGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALDELPLPPFLQPLDLTGKG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD9 ankyrin repeat domain 9 [ Homo sapiens ]
Official Symbol ANKRD9
Synonyms 2500003O20Rik; ANKR9_HUMAN; Ankrd9; Ankyrin repeat domain 9; Ankyrin repeat domain-containing protein 9; MGC21990; ANKRD9
Gene ID 122416
mRNA Refseq NM_152326.2
Protein Refseq NP_689539.1
UniProt ID Q96BM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD9 Products

Required fields are marked with *

My Review for All ANKRD9 Products

Required fields are marked with *

0
cart-icon