Recombinant Human Annexin A10, His-tagged

Cat.No. : ANXA10-5539H
Product Overview : Recombinant humanANXA10 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : ANXA10-5539H
Description : ANXA10,also known as Annexin A10, belongs to the annexin family of calcium-bindingproteins contains several family members that are characterized by aconserved core domain, which binds phospholipids in a Ca2+-dependent manner,and a unique amino-terminal region, which may confer binding specificity.
Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Molecular Weight : 39.8kDa(348aa) confirmed by MALDI-TOF
Purity : > 95%by SDS-PAGE
Concentration : 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMFCGDY VQGTIFPAPN FNPIMDAQML GGALQGFDCD KDMLINILTQ RCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFKDVMAGL MYPPPLYDAH ELWHAMKGVG TDENCLIEIL ASRTNGEIFQ MREAYCLQYS NNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQD AMVLWEACQQ KTGEHKTMLQ MILCNKSYQQ LRLVFQEFQN ISGQDMVDAI NECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFH NKTVIRILIA RSEIDLLTIR KRYKERYGKS LFHDIRNFAS GHYKKALLAI CAGDAEDY
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name : ANXA10 annexin A10 [ Homosapiens ]
Official Symbol : ANXA10
Synonyms : ANXA10; annexin A10; ANX14; annexin A10;annexin 14; annexin-10; annexin-14
Gene ID : 11199
mRNA Refseq : NM_007193
Protein Refseq : NP_009124
MIM : 608008
UniProt ID : Q9UJ72
Chromosome Location : 4q32.3
Function : calcium ion binding; calcium-dependentphospholipid binding

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (3)

Ask a question
Is ANXA10 protein localized in a specific subcellular compartment? 10/20/2020

ANXA10 protein is primarily known to localize to the cytoplasmic compartment of cells. It can also associate with cell membranes in some instances. However, the subcellular localization of ANXA10 may be cell type-specific and can vary depending on different physiological conditions.

Is ANXA10 protein involved in calcium signaling? 02/09/2019

Annexin proteins, including ANXA10, have been shown to interact with calcium ions and are involved in calcium signaling pathways. They can regulate calcium fluxes across membranes and participate in calcium-mediated processes such as neurotransmitter release, muscle contraction, and cell migration. While there is limited information specifically regarding ANXA10's role in calcium signaling, it is possible that it may contribute to these processes.

Is ANXA10 protein expressed in all tissues? 11/19/2017

The expression of ANXA10 protein has been reported to vary across different tissues. It appears to be more abundant in certain tissues, such as the liver and pancreas, while its expression in other tissues may be lower or undetectable.

Customer Reviews (4)

Write a review
Reviews
07/23/2021

    The outstanding level of customer service adds extra reassurance and confidence in using the ANXA10 protein for my scientific investigations.

    05/25/2021

      The ANXA10 protein surpasses expectations in terms of quality and will undoubtedly fulfill my experimental requirements.

      07/26/2017

        With the ANXA10 protein and its accompanying technical assistance, I am confident that I can achieve successful outcomes for my research endeavors.

        05/11/2016

          the manufacturer of ANXA10 provides exceptional technical support, offering valuable assistance in troubleshooting and experimental design.

          Ask a Question for All ANXA10 Products

          Required fields are marked with *

          My Review for All ANXA10 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends