Recombinant Human Annexin A10, His-tagged ANXA10-5539H

Recombinant Human Annexin A10, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Annexin A10, His-tagged

Recombinant Human Annexin A10, His-tagged Online Inquiry

ANXA10 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ANXA10-5539H Optional Service: Optional requirements on this protein
Product Overview : Recombinant humanANXA10 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description : ANXA10,also known as Annexin A10, belongs to the annexin family of calcium-bindingproteins contains several family members that are characterized by aconserved core domain, which binds phospholipids in a Ca2+-dependent manner,and a unique amino-terminal region, which may confer binding specificity.
Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Molecular Weight : 39.8kDa(348aa) confirmed by MALDI-TOF
Purity : > 95%by SDS-PAGE
Concentration : 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMFCGDY VQGTIFPAPN FNPIMDAQML GGALQGFDCD KDMLINILTQ RCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFKDVMAGL MYPPPLYDAH ELWHAMKGVG TDENCLIEIL ASRTNGEIFQ MREAYCLQYS NNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQD AMVLWEACQQ KTGEHKTMLQ MILCNKSYQQ LRLVFQEFQN ISGQDMVDAI NECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFH NKTVIRILIA RSEIDLLTIR KRYKERYGKS LFHDIRNFAS GHYKKALLAI CAGDAEDY
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name : ANXA10 annexin A10 [ Homosapiens ]
Official Symbol : ANXA10
Synonyms : ANXA10; annexin A10; ANX14; annexin A10;annexin 14; annexin-10; annexin-14
Gene ID : 11199
mRNA Refseq : NM_007193
Protein Refseq : NP_009124
MIM : 608008
UniProt ID : Q9UJ72
Chromosome Location : 4q32.3
Function : calcium ion binding; calcium-dependentphospholipid binding
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Q&As (0)

Ask a Question for All ANXA10 Products

Required fields are marked with *

  • Verification Code
×

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy