Recombinant Human ANO1 protein, His&Myc-tagged
Cat.No. : | ANO1-4534H |
Product Overview : | Recombinant Human ANO1 protein(Q5XXA6)(806-892aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 806-892aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA |
Gene Name | ANO1 anoctamin 1, calcium activated chloride channel [ Homo sapiens ] |
Official Symbol | ANO1 |
Synonyms | ANO1; anoctamin 1, calcium activated chloride channel; oral cancer overexpressed 2 , ORAOV2, TMEM16A, transmembrane protein 16A; anoctamin-1; DOG1; FLJ10261; TAOS2; oral cancer overexpressed 2; tumor-amplified and overexpressed sequence 2; discovered on gastrointestinal stromal tumors protein 1; transmembrane protein 16A (eight membrane-spanning domains); ORAOV2; TMEM16A; |
Gene ID | 55107 |
mRNA Refseq | NM_018043 |
Protein Refseq | NP_060513 |
MIM | 610108 |
UniProt ID | Q5XXA6 |
◆ Recombinant Proteins | ||
ANO1-7513Z | Recombinant Zebrafish ANO1 | +Inquiry |
ANO1-156H | Recombinant Human ANO1 Protein, His-tagged | +Inquiry |
Ano1-6890M | Recombinant Mouse Ano1 protein, His & T7-tagged | +Inquiry |
ANO1-12H | Recombinant Human ANO1 Protein, Met1-Ala333, N-His tagged | +Inquiry |
ANO1-4534H | Recombinant Human ANO1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANO1 Products
Required fields are marked with *
My Review for All ANO1 Products
Required fields are marked with *