Recombinant Human ANTXR1, His-tagged
| Cat.No. : | ANTXR1-38H |
| Product Overview : | Recombinant Human Anthrax Toxin Receptor 1/ANTXR1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu33-Ser321) of Human ANTXR1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 33-321 a.a. |
| Description : | Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothelial cells. ANTXR1 plays a role in cell attachment and migration. ANTXR1 interacts with extracellular matrix proteins and the actin cytoskeleton, it mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. It is also involved in the angiogenic response of cultured umbilical vein endothelial cells, up-regulated in cultured angiogenic umbilical vein endothelial cells. Defects in ANTXR1 are associated with susceptibility to hemangioma capillary infantile (HCI). |
| AA Sequence : | EDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTE DREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSE REANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAE PSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMK AALQVSMNDGLSFISSSVIITTTHCSLHKVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | ANTXR1 anthrax toxin receptor 1 [ Homo sapiens ] |
| Official Symbol | ANTXR1 |
| Synonyms | ANTXR1; anthrax toxin receptor 1; anthrax toxin receptor; ATR; FLJ10601; FLJ21776; TEM8; tumor endothelial marker 8 precursor; 2310008J16Rik; 2810405N18Rik; tumor endothelial marker 8; FLJ11298; |
| Gene ID | 84168 |
| mRNA Refseq | NM_018153 |
| Protein Refseq | NP_060623 |
| MIM | 606410 |
| UniProt ID | Q9H6X2 |
| Chromosome Location | 2p13.1 |
| Pathway | Cellular roles of Anthrax toxin, organism-specific biosystem; |
| Function | actin filament binding; collagen binding; metal ion binding; protein binding; receptor activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| ANTXR1-1475HF | Recombinant Full Length Human ANTXR1 Protein, GST-tagged | +Inquiry |
| ANTXR1-160H | Recombinant Human ANTXR1 Protein, His-tagged | +Inquiry |
| ANTXR1-687R | Recombinant Rat ANTXR1 Protein | +Inquiry |
| ANTXR1-7358H | Recombinant Human ANTXR1 protein(Met1-Ser321), hFc-tagged | +Inquiry |
| ANTXR1-625H | Recombinant Human ANTXR1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANTXR1-1463HCL | Recombinant Human ANTXR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANTXR1 Products
Required fields are marked with *
My Review for All ANTXR1 Products
Required fields are marked with *



