Recombinant Human ANXA2 protein(111-210 aa), C-His-tagged

Cat.No. : ANXA2-2583H
Product Overview : Recombinant Human ANXA2 protein(P07355)(111-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111-210 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 13.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : ASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV
Gene Name ANXA2 annexin A2 [ Homo sapiens ]
Official Symbol ANXA2
Synonyms ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV;
Gene ID 302
mRNA Refseq NM_001002857
Protein Refseq NP_001002857
MIM 151740
UniProt ID P07355

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANXA2 Products

Required fields are marked with *

My Review for All ANXA2 Products

Required fields are marked with *

0
cart-icon