Recombinant Human ANXA2 protein(111-210 aa), C-His-tagged
| Cat.No. : | ANXA2-2583H |
| Product Overview : | Recombinant Human ANXA2 protein(P07355)(111-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 111-210 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 13.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | ASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV |
| Gene Name | ANXA2 annexin A2 [ Homo sapiens ] |
| Official Symbol | ANXA2 |
| Synonyms | ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; |
| Gene ID | 302 |
| mRNA Refseq | NM_001002857 |
| Protein Refseq | NP_001002857 |
| MIM | 151740 |
| UniProt ID | P07355 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA2 Products
Required fields are marked with *
My Review for All ANXA2 Products
Required fields are marked with *
