Recombinant Human ANXA2 protein(111-210 aa), C-His-tagged
Cat.No. : | ANXA2-2583H |
Product Overview : | Recombinant Human ANXA2 protein(P07355)(111-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-210 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 13.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV |
Gene Name | ANXA2 annexin A2 [ Homo sapiens ] |
Official Symbol | ANXA2 |
Synonyms | ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; |
Gene ID | 302 |
mRNA Refseq | NM_001002857 |
Protein Refseq | NP_001002857 |
MIM | 151740 |
UniProt ID | P07355 |
◆ Recombinant Proteins | ||
Anxa2-165R | Recombinant Rat Anxa2 Protein, His-tagged | +Inquiry |
ANXA2-1845H | Recombinant Human Annexin A2, His-tagged | +Inquiry |
Anxa2-742M | Recombinant Mouse Anxa2 Protein, MYC/DDK-tagged | +Inquiry |
Anxa2-7844M | Recombinant Mouse Anxa2 protein, His-tagged | +Inquiry |
ANXA2-1041HF | Recombinant Full Length Human ANXA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA2-8834HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
ANXA2-8833HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA2 Products
Required fields are marked with *
My Review for All ANXA2 Products
Required fields are marked with *
0
Inquiry Basket