Recombinant Human ANXA2 protein
Cat.No. : | ANXA2-1846H |
Product Overview : | Recombinant Human ANXA2(Ser2-Asp339) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | Ser2-Asp339 |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 1mM EDTA, pH 7.5 |
AA Sequence : | MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN AQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIE IICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA RDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLV QCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKG DYQKALLYLCGGDD |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Gene Name | ANXA2 annexin A2 [ Homo sapiens ] |
Official Symbol | ANXA2 |
Synonyms | ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; |
Gene ID | 302 |
mRNA Refseq | NM_001002857 |
Protein Refseq | NP_001002857 |
MIM | 151740 |
UniProt ID | P07355 |
Chromosome Location | 15q22.2 |
Pathway | Prostaglandin Synthesis and Regulation, organism-specific biosystem; |
Function | Rab GTPase binding; calcium ion binding; calcium-dependent phospholipid binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase inhibitor activity; protein binding; |
◆ Recombinant Proteins | ||
Anxa2-7443M | Recombinant Human Anxa2 protein, hFc-tagged | +Inquiry |
ANXA2-582M | Recombinant Mouse ANXA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Anxa2-742M | Recombinant Mouse Anxa2 Protein, MYC/DDK-tagged | +Inquiry |
ANXA2-357H | Recombinant Human ANXA2 Protein, Flag-tagged | +Inquiry |
ANXA2-2516H | Recombinant Human ANXA2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA2-8833HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
ANXA2-8834HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA2 Products
Required fields are marked with *
My Review for All ANXA2 Products
Required fields are marked with *