Recombinant Human ANXA2 protein

• Cat.No.: ANXA2-1846H
• Product Overview: Recombinant Human ANXA2(Ser2-Asp339) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: Ser2-Asp339
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 1mM EDTA, pH 7.5
• AA Sequence: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN AQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIE IICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA RDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLV QCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKG DYQKALLYLCGGDD
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.

Gene Information

• Gene Name: ANXA2 annexin A2 [ Homo sapiens ]
• Official Symbol: ANXA2
• Synonyms: ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV
• Gene ID: 302
• mRNA Refseq: NM_001002857
• Protein Refseq: NP_001002857
• MIM: 151740
• UniProt ID: P07355
• Chromosome Location: 15q22.2
• Pathway: Prostaglandin Synthesis and Regulation, organism-specific biosystem
• Function: Rab GTPase binding; calcium ion binding; calcium-dependent phospholipid binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase inhibitor activity; protein binding