Recombinant Human ANXA4 protein, GST-tagged
Cat.No. : | ANXA4-634H |
Product Overview : | Human ANXA4 full-length ORF ( AAH00182, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 61.05 kDa |
AA Sequence : | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANXA4 annexin A4 [ Homo sapiens ] |
Official Symbol | ANXA4 |
Synonyms | ANXA4; annexin A4; ANX4; P32.5; PP4-X; PAP-II; annexin-4; protein II; endonexin I; lipocortin IV; chromobindin-4; 35-beta calcimedin; proliferation-inducing gene 28; proliferation-inducing protein 28; placental anticoagulant protein II; carbohydrate-binding protein p33/p41; annexin IV (placental anticoagulant protein II); PIG28; ZAP36; MGC75105; DKFZp686H02120; |
Gene ID | 307 |
mRNA Refseq | NM_001153 |
Protein Refseq | NP_001144 |
MIM | 106491 |
UniProt ID | P09525 |
◆ Recombinant Proteins | ||
ANXA4-339R | Recombinant Rhesus monkey ANXA4 Protein, His-tagged | +Inquiry |
Anxa4-1336M | Recombinant Mouse Anxa4 protein, His-tagged | +Inquiry |
Anxa4-1340R | Recombinant Rat Anxa4 protein, His-tagged | +Inquiry |
Anxa4-3496R | Recombinant Rat Anxa4, His-tagged | +Inquiry |
ANXA4-1044HF | Recombinant Full Length Human ANXA4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA4-8831HCL | Recombinant Human ANXA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA4 Products
Required fields are marked with *
My Review for All ANXA4 Products
Required fields are marked with *
0
Inquiry Basket