Recombinant Human ANXA5 protein, His-tagged, Animal-Free

• Cat.No.: ANXA5-454H
• Product Overview: Recombinant Human ANXA5 protein(P08758) with C-terminal His tag was expressed in E. coli and Animal-free.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4.
• Molecular Mass: The protein has a calculated MW of 36.75 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis).
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Gene Information

• Gene Name: ANXA5 annexin A5 [ Homo sapiens ]
• Official Symbol: ANXA5
• Synonyms: ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2
• Gene ID: 308
• mRNA Refseq: NM_001154
• Protein Refseq: NP_001145
• MIM: 131230
• UniProt ID: P08758