Recombinant Human ANXA5 protein, His-tagged, Animal-Free
Cat.No. : | ANXA5-454H |
Product Overview : | Recombinant Human ANXA5 protein(P08758) with C-terminal His tag was expressed in E. coli and Animal-free. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. |
Molecular Mass : | The protein has a calculated MW of 36.75 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis). |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
Official Symbol | ANXA5 |
Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2 |
Gene ID | 308 |
mRNA Refseq | NM_001154 |
Protein Refseq | NP_001145 |
MIM | 131230 |
UniProt ID | P08758 |
◆ Recombinant Proteins | ||
ANXA5-001H | Recombinant Human ANXA5 Protein, His-tagged | +Inquiry |
ANXA5-9698H | Recombinant Human ANXA5, His-tagged | +Inquiry |
Anxa5-7163M | Recombinant Mouse Anxa5 Protein, His-tagged | +Inquiry |
ANXA5-310C | Recombinant Chicken ANXA5 Protein, His-tagged | +Inquiry |
ANXA5-1071H | Recombinant Human ANXA5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
0
Inquiry Basket