Recombinant Human ANXA5 protein, His-tagged, Animal-Free
| Cat.No. : | ANXA5-454H |
| Product Overview : | Recombinant Human ANXA5 protein(P08758) with C-terminal His tag was expressed in E. coli and Animal-free. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. |
| Molecular Mass : | The protein has a calculated MW of 36.75 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis). |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : | >98% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
| Official Symbol | ANXA5 |
| Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2 |
| Gene ID | 308 |
| mRNA Refseq | NM_001154 |
| Protein Refseq | NP_001145 |
| MIM | 131230 |
| UniProt ID | P08758 |
| ◆ Recombinant Proteins | ||
| ANXA5-2521C | Recombinant Cynops pyrrhogaster ANXA5 protein, His-tagged | +Inquiry |
| ANXA5-2623H | Recombinant Human Annexin A5, APC | +Inquiry |
| ANXA5-01C | Recombinant Chicken ANXA5 Protein tagged | +Inquiry |
| ANXA5-585M | Recombinant Mouse ANXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANXA5-0428H | Active Recombinant Human ANXA5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA5-038HKCL | Human ANXA5 Knockdown Cell Lysate | +Inquiry |
| ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *
