Recombinant Human ANXA9 protein, GST-tagged

Cat.No. : ANXA9-639H
Product Overview : Human ANXA9 partial ORF ( NP_003559.1, 270 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact. [provided by RefSeq, Jul 200
Molecular Mass : 33.33 kDa
AA Sequence : DKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANXA9 annexin A9 [ Homo sapiens ]
Official Symbol ANXA9
Synonyms ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI;
Gene ID 8416
mRNA Refseq NM_003568
Protein Refseq NP_003559
MIM 603319
UniProt ID O76027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANXA9 Products

Required fields are marked with *

My Review for All ANXA9 Products

Required fields are marked with *

0
cart-icon
0
compare icon