Recombinant Human ANXA9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ANXA9-6560H |
Product Overview : | ANXA9 MS Standard C13 and N15-labeled recombinant protein (NP_003559) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact. |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ANXA9 annexin A9 [ Homo sapiens (human) ] |
Official Symbol | ANXA9 |
Synonyms | ANXA9; annexin A9; ANX31; annexin-9; pemphaxin; annexin 31; annexin-31; annexin XXXI; |
Gene ID | 8416 |
mRNA Refseq | NM_003568 |
Protein Refseq | NP_003559 |
MIM | 603319 |
UniProt ID | O76027 |
◆ Recombinant Proteins | ||
ANXA9-5261H | Recombinant Human Annexin A9, His-tagged | +Inquiry |
ANXA9-1721M | Recombinant Mouse ANXA9 Protein | +Inquiry |
ANXA9-0254H | Recombinant Human ANXA9 Protein (Met8-Met345), N-GST-tagged | +Inquiry |
ANXA9-001H | Recombinant Human ANXA9 Protein, His-tagged | +Inquiry |
ANXA9-5262H | Recombinant Human ANXA9 protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA9-8825HCL | Recombinant Human ANXA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA9 Products
Required fields are marked with *
My Review for All ANXA9 Products
Required fields are marked with *
0
Inquiry Basket