Recombinant Human AP1S3 Protein (1-104 aa), GST-tagged

Cat.No. : AP1S3-330H
Product Overview : Recombinant Human AP1S3 Protein (1-104 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 3.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-104 aa
Description : Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.7 kDa
AA Sequence : MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name AP1S3 adaptor related protein complex 1 subunit sigma 3 [ Homo sapiens (human) ]
Official Symbol AP1S3
Synonyms PSORS15;
Gene ID 130340
mRNA Refseq NM_001039569
Protein Refseq NP_001034658
UniProt ID Q96PC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1S3 Products

Required fields are marked with *

My Review for All AP1S3 Products

Required fields are marked with *

0
cart-icon
0
compare icon