Recombinant Human AP1S3 Protein (1-104 aa), GST-tagged
Cat.No. : | AP1S3-330H |
Product Overview : | Recombinant Human AP1S3 Protein (1-104 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Isoform 3. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-104 aa |
Description : | Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | AP1S3 adaptor related protein complex 1 subunit sigma 3 [ Homo sapiens (human) ] |
Official Symbol | AP1S3 |
Synonyms | PSORS15; |
Gene ID | 130340 |
mRNA Refseq | NM_001039569 |
Protein Refseq | NP_001034658 |
UniProt ID | Q96PC3 |
◆ Recombinant Proteins | ||
AP1S3-599M | Recombinant Mouse AP1S3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP1S3-330H | Recombinant Human AP1S3 Protein (1-104 aa), GST-tagged | +Inquiry |
AP1S3-2218C | Recombinant Chicken AP1S3 | +Inquiry |
AP1S3-1737M | Recombinant Mouse AP1S3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AP1S3 Products
Required fields are marked with *
My Review for All AP1S3 Products
Required fields are marked with *
0
Inquiry Basket