Recombinant Human AP2A1, His-tagged
Cat.No. : | AP2A1-27357TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 734-950 of Human AP2 alpha isoform B, with a N terminal His tag; predicted MWt 25kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 734-950 a.a. |
Description : | This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. |
Conjugation : | HIS |
Tissue specificity : | Isoform A expressed in forebrain, skeletal muscle, spinal cord, cerebellum, salivary gland, heart and colon. Isoform B is widely expressed in tissues and also in breast cancer and in prostate carcinoma cells. |
Form : | Lyophilised:Reconstitution with 45 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTV VHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRD FLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMA AQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGF GSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNA QAQMYRLTLRTSKEPVSRHLCEL |
Sequence Similarities : | Belongs to the adaptor complexes large subunit family. |
Gene Name | AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ] |
Official Symbol | AP2A1 |
Synonyms | AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1; |
Gene ID | 160 |
mRNA Refseq | NM_014203 |
Protein Refseq | NP_055018 |
MIM | 601026 |
Uniprot ID | O95782 |
Chromosome Location | 19q13.3 |
Pathway | Arf1 pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EGFR downregulation, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; |
Function | protein C-terminus binding; protein binding; protein transporter activity; |
◆ Recombinant Proteins | ||
AP2A1-175R | Recombinant Rhesus Macaque AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2A1-27357TH | Recombinant Human AP2A1, His-tagged | +Inquiry |
Ap2a1-3530M | Recombinant Mouse Ap2a1, His-tagged | +Inquiry |
AP2A1-600M | Recombinant Mouse AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2A1-651H | Recombinant Human AP2A1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP2A1 Products
Required fields are marked with *
My Review for All AP2A1 Products
Required fields are marked with *