Recombinant Human AP3S1 protein, GST-tagged
Cat.No. : | AP3S1-659H |
Product Overview : | Human AP3S1 full-length ORF ( AAH00804.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the AP3 adaptor complex. This complex functions in the formation of subcellular vesicles budded from the Golgi body. Several related pseudogenes of this gene have been found. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 46.86 kDa |
AA Sequence : | MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP3S1 adaptor-related protein complex 3, sigma 1 subunit [ Homo sapiens ] |
Official Symbol | AP3S1 |
Synonyms | AP3S1; adaptor-related protein complex 3, sigma 1 subunit; CLAPS3; AP-3 complex subunit sigma-1; sigma3A-adaptin; sigma-3A-adaptin; sigma-adaptin 3a; AP-3 complex sigma-3A subunit; AP-3 complex subunit sigma-3A; adapter-related protein complex 3 sigma-1 subunit; clathrin-associated/assembly/adapter protein, small 3; clathrin-associated/assembly/adaptor protein, small 3 (22kD); Sigma3A; |
Gene ID | 1176 |
mRNA Refseq | NM_001284 |
Protein Refseq | NP_001275 |
MIM | 601507 |
UniProt ID | Q92572 |
◆ Recombinant Proteins | ||
AP3S1-191H | Recombinant Human AP3S1 Protein, His-tagged | +Inquiry |
AP3S1-1723C | Recombinant Chicken AP3S1 | +Inquiry |
AP3S1-659H | Recombinant Human AP3S1 protein, GST-tagged | +Inquiry |
Ap3s1-192R | Recombinant Rat Ap3s1 Protein, His-tagged | +Inquiry |
AP3S1-364H | Recombinant Human adaptor-related protein complex 3, sigma 1 subunit, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP3S1-8808HCL | Recombinant Human AP3S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP3S1 Products
Required fields are marked with *
My Review for All AP3S1 Products
Required fields are marked with *
0
Inquiry Basket