Recombinant Human AP3S2 protein, GST-tagged
| Cat.No. : | AP3S2-660H | 
| Product Overview : | Human AP3S2 full-length ORF ( NP_005820.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | AP3S2 (Adaptor Related Protein Complex 3 Sigma 2 Subunit) is a Protein Coding gene. Among its related pathways are Lysosome. GO annotations related to this gene include protein transporter activity. An important paralog of this gene is AP3S1. | 
| Molecular Mass : | 48.4 kDa | 
| AA Sequence : | MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV | 
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | AP3S2 adaptor-related protein complex 3, sigma 2 subunit [ Homo sapiens ] | 
| Official Symbol | AP3S2 | 
| Synonyms | AP3S2; adaptor-related protein complex 3, sigma 2 subunit; AP-3 complex subunit sigma-2; sigma3b; sigma-3B-adaptin; sigma-adaptin 3b; adaptor complex sigma3B; AP-3 complex subunit sigma-3B; clathrin-associated/assembly/adaptor protein, small 4, 22-kD; AP3S3; FLJ35955; | 
| Gene ID | 10239 | 
| mRNA Refseq | NM_005829 | 
| Protein Refseq | NP_005820 | 
| MIM | 602416 | 
| UniProt ID | P59780 | 
| ◆ Recombinant Proteins | ||
| AP3S2-5501C | Recombinant Chicken AP3S2 | +Inquiry | 
| AP3S2-5502C | Recombinant Chicken AP3S2 | +Inquiry | 
| AP3S2-1117HF | Recombinant Full Length Human AP3S2 Protein, GST-tagged | +Inquiry | 
| AP3S2-71H | Recombinant Human AP3S2, T7-tagged | +Inquiry | 
| AP3S2-350R | Recombinant Rhesus monkey AP3S2 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AP3S2-8807HCL | Recombinant Human AP3S2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP3S2 Products
Required fields are marked with *
My Review for All AP3S2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            