Recombinant Human AP3S2 protein, GST-tagged

Cat.No. : AP3S2-660H
Product Overview : Human AP3S2 full-length ORF ( NP_005820.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AP3S2 (Adaptor Related Protein Complex 3 Sigma 2 Subunit) is a Protein Coding gene. Among its related pathways are Lysosome. GO annotations related to this gene include protein transporter activity. An important paralog of this gene is AP3S1.
Molecular Mass : 48.4 kDa
AA Sequence : MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP3S2 adaptor-related protein complex 3, sigma 2 subunit [ Homo sapiens ]
Official Symbol AP3S2
Synonyms AP3S2; adaptor-related protein complex 3, sigma 2 subunit; AP-3 complex subunit sigma-2; sigma3b; sigma-3B-adaptin; sigma-adaptin 3b; adaptor complex sigma3B; AP-3 complex subunit sigma-3B; clathrin-associated/assembly/adaptor protein, small 4, 22-kD; AP3S3; FLJ35955;
Gene ID 10239
mRNA Refseq NM_005829
Protein Refseq NP_005820
MIM 602416
UniProt ID P59780

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP3S2 Products

Required fields are marked with *

My Review for All AP3S2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon