"AP3S2" Related Products

Expand
Expand

Recombinant Human AP3S2 protein, GST-tagged

Cat.No. : AP3S2-660H
Product Overview : Human AP3S2 full-length ORF ( NP_005820.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
Description : AP3S2 (Adaptor Related Protein Complex 3 Sigma 2 Subunit) is a Protein Coding gene. Among its related pathways are Lysosome. GO annotations related to this gene include protein transporter activity. An important paralog of this gene is AP3S1.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 48.4 kDa
AA Sequence : MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : AP3S2 adaptor-related protein complex 3, sigma 2 subunit [ Homo sapiens ]
Official Symbol : AP3S2
Synonyms : AP3S2; adaptor-related protein complex 3, sigma 2 subunit; AP-3 complex subunit sigma-2; sigma3b; sigma-3B-adaptin; sigma-adaptin 3b; adaptor complex sigma3B; AP-3 complex subunit sigma-3B; clathrin-associated/assembly/adaptor protein, small 4, 22-kD; AP3S3; FLJ35955;
Gene ID : 10239
mRNA Refseq : NM_005829
Protein Refseq : NP_005820
MIM : 602416
UniProt ID : P59780

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.