Recombinant Human AP4M1 protein, GST-tagged

Cat.No. : AP4M1-663H
Product Overview : Human AP4M1 full-length ORF ( AAH18705, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. [provided by RefSeq, Jul 2008]
Molecular Mass : 75.57 kDa
AA Sequence : MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP4M1 adaptor-related protein complex 4, mu 1 subunit [ Homo sapiens ]
Official Symbol AP4M1
Synonyms AP4M1; adaptor-related protein complex 4, mu 1 subunit; AP-4 complex subunit mu-1; adaptor related protein complex AP 4 mu4 subunit; AP 4 adapter complex mu subunit; mu subunit of AP 4; MU 4; mu adaptin related protein 2; MU ARP2; mu4; mu4-adaptin; mu subunit of AP-4; mu-adaptin-related protein 2; mu-adaptin-related protein-2; adapter-related protein complex 4 mu-1 subunit; adaptor-related protein complex AP-4 mu4 subunit; MU-4; CPSQ3; MU-ARP2;
Gene ID 9179
mRNA Refseq NM_004722
Protein Refseq NP_004713
MIM 602296
UniProt ID O00189

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP4M1 Products

Required fields are marked with *

My Review for All AP4M1 Products

Required fields are marked with *

0
cart-icon
0
compare icon