Recombinant Human AP4M1 protein, GST-tagged
Cat.No. : | AP4M1-663H |
Product Overview : | Human AP4M1 full-length ORF ( AAH18705, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 75.57 kDa |
AA Sequence : | MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP4M1 adaptor-related protein complex 4, mu 1 subunit [ Homo sapiens ] |
Official Symbol | AP4M1 |
Synonyms | AP4M1; adaptor-related protein complex 4, mu 1 subunit; AP-4 complex subunit mu-1; adaptor related protein complex AP 4 mu4 subunit; AP 4 adapter complex mu subunit; mu subunit of AP 4; MU 4; mu adaptin related protein 2; MU ARP2; mu4; mu4-adaptin; mu subunit of AP-4; mu-adaptin-related protein 2; mu-adaptin-related protein-2; adapter-related protein complex 4 mu-1 subunit; adaptor-related protein complex AP-4 mu4 subunit; MU-4; CPSQ3; MU-ARP2; |
Gene ID | 9179 |
mRNA Refseq | NM_004722 |
Protein Refseq | NP_004713 |
MIM | 602296 |
UniProt ID | O00189 |
◆ Recombinant Proteins | ||
AP4M1-1095HF | Recombinant Full Length Human AP4M1 Protein, GST-tagged | +Inquiry |
Ap4m1-196M | Recombinant Mouse Ap4m1 Protein, His-tagged | +Inquiry |
AP4M1-609M | Recombinant Mouse AP4M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP4M1-1752M | Recombinant Mouse AP4M1 Protein | +Inquiry |
AP4M1-704R | Recombinant Rat AP4M1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP4M1-88HCL | Recombinant Human AP4M1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP4M1 Products
Required fields are marked with *
My Review for All AP4M1 Products
Required fields are marked with *