Recombinant Human APBB1IP protein, GST-tagged
| Cat.No. : | APBB1IP-669H |
| Product Overview : | Human APBB1IP full-length ORF ( AAH35636, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | APBB1IP (Amyloid Beta Precursor Protein Binding Family B Member 1 Interacting Protein) is a Protein Coding gene. Among its related pathways are RET signaling and Immune System. An important paralog of this gene is RAPH1. |
| Molecular Mass : | 44.66 kDa |
| AA Sequence : | MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APBB1IP amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein [ Homo sapiens ] |
| Official Symbol | APBB1IP |
| Synonyms | APBB1IP; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; INAG1; Rap1 GTP interacting adaptor molecule; RIAM; PREL-1; RARP-1; proline-rich protein 73; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; APBB1-interacting protein 1; Rap1-interacting adaptor molecule; Rap1-GTP-interacting adaptor molecule; rap1-GTP-interacting adapter molecule; retinoic acid-responsive proline-rich protein 1; PREL1; RARP1; |
| Gene ID | 54518 |
| mRNA Refseq | NM_019043 |
| Protein Refseq | NP_061916 |
| MIM | 609036 |
| UniProt ID | Q7Z5R6 |
| ◆ Recombinant Proteins | ||
| APBB1IP-1780HFL | Recombinant Full Length Human APBB1IP Protein, C-Flag-tagged | +Inquiry |
| APBB1IP-01H | Recombinant Human APBB1IP Protein, His-tagged | +Inquiry |
| APBB1IP-10906Z | Recombinant Zebrafish APBB1IP | +Inquiry |
| APBB1IP-1206HF | Recombinant Full Length Human APBB1IP Protein, GST-tagged | +Inquiry |
| APBB1IP-228H | Recombinant Human APBB1IP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APBB1IP-29HCL | Recombinant Human APBB1IP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APBB1IP Products
Required fields are marked with *
My Review for All APBB1IP Products
Required fields are marked with *
