Recombinant Human APBB1IP protein, GST-tagged

Cat.No. : APBB1IP-669H
Product Overview : Human APBB1IP full-length ORF ( AAH35636, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : APBB1IP (Amyloid Beta Precursor Protein Binding Family B Member 1 Interacting Protein) is a Protein Coding gene. Among its related pathways are RET signaling and Immune System. An important paralog of this gene is RAPH1.
Molecular Mass : 44.66 kDa
AA Sequence : MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APBB1IP amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein [ Homo sapiens ]
Official Symbol APBB1IP
Synonyms APBB1IP; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; INAG1; Rap1 GTP interacting adaptor molecule; RIAM; PREL-1; RARP-1; proline-rich protein 73; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; APBB1-interacting protein 1; Rap1-interacting adaptor molecule; Rap1-GTP-interacting adaptor molecule; rap1-GTP-interacting adapter molecule; retinoic acid-responsive proline-rich protein 1; PREL1; RARP1;
Gene ID 54518
mRNA Refseq NM_019043
Protein Refseq NP_061916
MIM 609036
UniProt ID Q7Z5R6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APBB1IP Products

Required fields are marked with *

My Review for All APBB1IP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon