Recombinant Human APBB1IP Protein, His-tagged

Cat.No. : APBB1IP-01H
Product Overview : Recombinant Human APBB1IP Protein with His tag was expressed in E. coli.
Availability June 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-89 aa
Description : Predicted to be involved in signal transduction. Predicted to act upstream of or within T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell and positive regulation of cell adhesion. Located in cytosol and plasma membrane.
Tag : C-His
Molecular Mass : 11 kDa
AA Sequence : MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESHHHHHHHH
Endotoxin : < 1 EU/μg of protein determined by LAL method
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.56 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Gene Name APBB1IP amyloid beta precursor protein binding family B member 1 interacting protein [ Homo sapiens (human) ]
Official Symbol APBB1IP
Synonyms APBB1IP; amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein; amyloid beta A4 precursor protein-binding family B member 1-interacting protein; INAG1; Rap1 GTP interacting adaptor molecule; RIAM; PREL-1; RARP-1; proline-rich protein 73; proline rich EVH1 ligand 1; proline-rich EVH1 ligand 1; APBB1-interacting protein 1; Rap1-interacting adaptor molecule; Rap1-GTP-interacting adaptor molecule; rap1-GTP-interacting adapter molecule; retinoic acid-responsive proline-rich protein 1; PREL1; RARP1
Gene ID 54518
mRNA Refseq NM_019043
Protein Refseq NP_061916
MIM 609036
UniProt ID Q7Z5R6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APBB1IP Products

Required fields are marked with *

My Review for All APBB1IP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon