Recombinant Human APEX1 protein, His-tagged
| Cat.No. : | APEX1-2528H |
| Product Overview : | Recombinant Human APEX1 protein(P27695)(32-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 32-318aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ] |
| Official Symbol | APEX1 |
| Synonyms | APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX; |
| Gene ID | 328 |
| mRNA Refseq | NM_001244249 |
| Protein Refseq | NP_001231178 |
| MIM | 107748 |
| UniProt ID | P27695 |
| ◆ Recombinant Proteins | ||
| APEX1-1523HF | Recombinant Full Length Human APEX1 Protein, GST-tagged | +Inquiry |
| APEX1-2497H | Recombinant Human APEX1 protein(Pro2-Leu318), His-tagged | +Inquiry |
| APEX1-2705H | Recombinant Human APEX1 protein(11-90 aa), C-His-tagged | +Inquiry |
| APEX1-182R | Recombinant Rhesus Macaque APEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APEX1-955H | Recombinant Human APEX1, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
| APEX1-043HKCL | Human APEX1 Knockdown Cell Lysate | +Inquiry |
| APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
