Recombinant Human APEX1 protein, His-tagged
Cat.No. : | APEX1-2528H |
Product Overview : | Recombinant Human APEX1 protein(P27695)(32-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-318aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ] |
Official Symbol | APEX1 |
Synonyms | APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX; |
Gene ID | 328 |
mRNA Refseq | NM_001244249 |
Protein Refseq | NP_001231178 |
MIM | 107748 |
UniProt ID | P27695 |
◆ Recombinant Proteins | ||
APEX1-1538H | Recombinant Human APEX1 protein | +Inquiry |
APEX1-369R | Recombinant Rat APEX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APEX1-1330H | Recombinant Human APEX1 Protein (32-318 aa), His-tagged | +Inquiry |
Apex1-623M | Recombinant Mouse Apex1 Protein, MYC/DDK-tagged | +Inquiry |
APEX1-713R | Recombinant Rat APEX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APEX1-8797HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
APEX1-8796HCL | Recombinant Human APEX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APEX1 Products
Required fields are marked with *
My Review for All APEX1 Products
Required fields are marked with *
0
Inquiry Basket