Recombinant Human APH1A Full Length Transmembrane protein (1-247 aa), His-SUMO-tagged
Cat.No. : | APH1A-2712H |
Product Overview : | Recombinant Human APH1A Protein (1-247 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.9kDa |
AA Sequence : | MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APH1A anterior pharynx defective 1 homolog A (C. elegans) [ Homo sapiens ] |
Official Symbol | APH1A |
Synonyms | APH1A; anterior pharynx defective 1 homolog A (C. elegans); gamma-secretase subunit APH-1A; APH 1A; CGI 78; aph-1alpha; presenilin-stabilization factor; APH-1; APH-1A; CGI-78; 6530402N02Rik; |
Gene ID | 51107 |
mRNA Refseq | NM_001077628 |
Protein Refseq | NP_001071096 |
MIM | 607629 |
UniProt ID | Q96BI3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APH1A Products
Required fields are marked with *
My Review for All APH1A Products
Required fields are marked with *
0
Inquiry Basket