Recombinant Human APLN protein, GST-tagged
| Cat.No. : | APLN-301470H |
| Product Overview : | Recombinant Human APLN (38-77 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asn38-Phe77 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | NVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | APLN apelin [ Homo sapiens ] |
| Official Symbol | APLN |
| Synonyms | APLN; apelin; apelin, AGTRL1 ligand; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; APEL; |
| Gene ID | 8862 |
| mRNA Refseq | NM_017413 |
| Protein Refseq | NP_059109 |
| MIM | 300297 |
| UniProt ID | Q9ULZ1 |
| ◆ Recombinant Proteins | ||
| APLN-301470H | Recombinant Human APLN protein, GST-tagged | +Inquiry |
| Apln-8264R | Recombinant Rat Apln protein, His & S-tagged | +Inquiry |
| APLN-7588Z | Recombinant Zebrafish APLN | +Inquiry |
| APLN-8262H | Recombinant Human APLN protein, His & MBP-tagged | +Inquiry |
| APLN-2368M | Recombinant Mouse APLN protein(Met1-Phe77), mFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APLN-8792HCL | Recombinant Human APLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APLN Products
Required fields are marked with *
My Review for All APLN Products
Required fields are marked with *



