Recombinant Human APLP1, His-tagged
Cat.No. : | APLP1-26119TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 274-651 a.a. |
Description : | This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Tissue specificity : | Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP |
Sequence Similarities : | Belongs to the APP family. |
Gene Name | APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ] |
Official Symbol | APLP1 |
Synonyms | APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP; |
Gene ID | 333 |
mRNA Refseq | NM_001024807 |
Protein Refseq | NP_001019978 |
MIM | 104775 |
Uniprot ID | P51693 |
Chromosome Location | 19q |
Function | alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding; |
◆ Recombinant Proteins | ||
APLP1-394H | Recombinant Human APLP1 Protein, His-tagged | +Inquiry |
RFL-30829MF | Recombinant Full Length Mouse Amyloid-Like Protein 1(Aplp1) Protein, His-Tagged | +Inquiry |
APLP1-1776M | Recombinant Mouse APLP1 Protein | +Inquiry |
APLP1-26119TH | Recombinant Human APLP1, His-tagged | +Inquiry |
APLP1-350H | Recombinant Human APLP1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APLP1-1031HCL | Recombinant Human APLP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APLP1 Products
Required fields are marked with *
My Review for All APLP1 Products
Required fields are marked with *