Recombinant Human Apo-SAA1 Protein
| Cat.No. : | Apo-SAA1-3553H |
| Product Overview : | Recombinant Human Apo-SAA1 Protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | Lyophilized |
| Bio-activity : | Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/mL. |
| Molecular Mass : | 11.7 kDa |
| AASequence : | MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Endotoxin : | <1 EU/μg |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Storage : | At -20 centigrade |
| Shipping : | Ambient |
| Gene Name | SAA1 serum amyloid A1 [ Homo sapiens (human) ] |
| Official Symbol | SAA1 |
| Synonyms | SAA1; serum amyloid A1; SAA; PIG4; SAA2; TP53I4; serum amyloid A-1 protein; serum amyloid A protein; tumor protein p53 inducible protein 4 |
| Gene ID | 6288 |
| mRNA Refseq | NM_000331 |
| Protein Refseq | NP_000322 |
| MIM | 104750 |
| UniProt ID | P02735 |
| ◆ Recombinant Proteins | ||
| Apo-SAA1-3553H | Recombinant Human Apo-SAA1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apo-SAA1 Products
Required fields are marked with *
My Review for All Apo-SAA1 Products
Required fields are marked with *
Recently Viewed
