Recombinant Human APOA1 protein

Cat.No. : APOA1-698H
Product Overview : Recombinant Human APOA1 protein was expressed in Escherichia coli.
Availability February 01, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 243
Description : This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 28.1 kDa, a single non-glycosylated polypeptide chain containing 243 amino acids.
AA Sequence : DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Endotoxin : Less than 0.1 EU/µg of rHuApoA-I as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Publications :
Gene Name APOA1
Official Symbol APOA1
Synonyms APOA1; apolipoprotein A-I; apo-AI; apoA-I; MGC117399;
Gene ID 335
mRNA Refseq NM_000039
Protein Refseq NP_000030
MIM 107680
UniProt ID P02647

Imipramine and olanzapine block apoE4-catalyzed polymerization of Aβ and show evidence of improving Alzheimer’s disease cognition

Journal: Alzheimer's Research & Therapy    PubMed ID: 35768831    Data: 2022/6/29

Authors: Noah R. Johnson, Athena C.-J. Wang, Huntington Potter

Article Snippet:Once the optimal concentrations of approximately 20 μM Aβ42, 1 nM apoE, and 15 μM ThT were determined, they were maintained throughout subsequent studies unless noted otherwise.Once the optimal concentrations of approximately 20 μM Aβ42, 1 nM apoE, and 15 μM ThT were determined, they were maintained throughout subsequent studies unless noted otherwise.. For HTS assay validation, recombinant human Aβ40 (rPeptide), recombinant human scrambled Aβ42 (rPeptide), recombinant human apoE2 and apoE3 (Creative BioMart), recombinant human apolipoprotein A-I (apoA-I; Creative BioMart), human plasma-derived apoE (Sigma), or dimethyl sulfoxide (DMSO; Sigma) were included or substituted at the indicated concentrations.. In assay optimization experiments, 3?8 wells were used per group and experiments were replicated one or two times, as indicated in the figure legends.In assay optimization experiments, 3?8 wells were used per group and experiments were replicated one or two times, as indicated in the figure legends.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOA1 Products

Required fields are marked with *

My Review for All APOA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon